DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr92A and Cpr64Aa

DIOPT Version :9

Sequence 1:NP_650813.2 Gene:Cpr92A / 42333 FlyBaseID:FBgn0038714 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_647872.1 Gene:Cpr64Aa / 38508 FlyBaseID:FBgn0035510 Length:192 Species:Drosophila melanogaster


Alignment Length:218 Identity:101/218 - (46%)
Similarity:126/218 - (57%) Gaps:39/218 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ISLLSAMLGIAYAGVIGPGPYYGGPAGPGPLHHYGGYAPQHGPLPGPYVAPKPAAPEPYDPDPKY 68
            |.:|||::.::.| |:.|||....||       |..| |....:..|.|| |.|.||||||:|:|
  Fly     6 ILVLSALVAVSSA-VVVPGPGLALPA-------YPSY-PALAKVAAPLVA-KVAGPEPYDPNPQY 60

  Fly    69 SFGYDIQDGYTGDLKSQHETRHGDVVKGSYSVVDPDGTKRTVDYTADPHHGFNAVVRKEPLAYKA 133
            :|.||:.||.|||:|||.|||.||||:|:||:::.|||:|.|:|||||.||||||||:|....||
  Fly    61 TFSYDVHDGSTGDVKSQQETRSGDVVQGAYSLIEADGTRRIVEYTADPVHGFNAVVRREGAVVKA 125

  Fly   134 PAHLAPVVAPAP--------APVPAHYGPAPAPPLPPVPKAPLLSYPLALGPYHRGAPAPAPGPA 190
            .|.:|.|:||||        |.||| ||||.||           :||         |.|...|||
  Fly   126 VAPVAKVLAPAPLLHASPLVAKVPA-YGPALAP-----------AYP---------ALAHGYGPA 169

  Fly   191 PAPAPAPVSVPVATPVLPSAHFH 213
            .|||..|....:|.|.|....:|
  Fly   170 LAPAYGPALPKLALPALSPLGYH 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr92ANP_650813.2 PHA03185 <21..77 CDD:177553 24/55 (44%)
Chitin_bind_4 68..120 CDD:278791 33/51 (65%)
Cpr64AaNP_647872.1 Chitin_bind_4 60..112 CDD:278791 33/51 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D147941at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.