DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr92A and Cpr57A

DIOPT Version :10

Sequence 1:NP_650813.2 Gene:Cpr92A / 42333 FlyBaseID:FBgn0038714 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_611489.1 Gene:Cpr57A / 37319 FlyBaseID:FBgn0034517 Length:184 Species:Drosophila melanogaster


Alignment Length:119 Identity:38/119 - (31%)
Similarity:48/119 - (40%) Gaps:29/119 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 PEPYDPDPKYSFGYDIQDGYT-GDLKSQH-ETRHGD-VVKGSYSVVDPDGTKRTVDYTADPHHGF 120
            |||..|...|.|.|  |.|.. |.:..|| |...|. |::|::|.|||....|||.|.|| .|||
  Fly    23 PEPKVPASPYVFSY--QAGRAPGHVDRQHTEVSDGSGVIRGAFSYVDPKNQVRTVQYVAD-EHGF 84

  Fly   121 N--------------AVVRKEPLAYK---------APAHLAPVVAPAPAPVPAH 151
            :              |..::...||.         .|..:|...||..:...||
  Fly    85 HPQLSHKLEDSAAVQAAKQRHFAAYNRIAQEHANHTPGQVALANAPHASAAVAH 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr92ANP_650813.2 Chitin_bind_4 68..120 CDD:459790 23/54 (43%)
Cpr57ANP_611489.1 Chitin_bind_4 32..84 CDD:459790 23/54 (43%)

Return to query results.
Submit another query.