DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr92A and Cpr49Ah

DIOPT Version :10

Sequence 1:NP_650813.2 Gene:Cpr92A / 42333 FlyBaseID:FBgn0038714 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_610777.1 Gene:Cpr49Ah / 36354 FlyBaseID:FBgn0033731 Length:190 Species:Drosophila melanogaster


Alignment Length:84 Identity:27/84 - (32%)
Similarity:35/84 - (41%) Gaps:17/84 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 KYSFGYDIQDGYTGDLKSQHETRHGDVVK-GSYSVVDPDGTKRTVDYTADPHHGFNAVVRKEPLA 130
            :|..|..|....||.||......:|.:|: |.||...|:||...|.|||| .:||.|        
  Fly    69 EYETGNSIIHEETGFLKDFDTNPNGVLVQHGQYSYQSPEGTLVNVQYTAD-ENGFRA-------- 124

  Fly   131 YKAPAHLAPVVAPAPAPVP 149
              ...|:     |.|..:|
  Fly   125 --TGDHI-----PTPPAIP 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr92ANP_650813.2 Chitin_bind_4 68..120 CDD:459790 20/52 (38%)
Cpr49AhNP_610777.1 Chitin_bind_4 66..122 CDD:459790 20/53 (38%)

Return to query results.
Submit another query.