DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr92A and LOC3290497

DIOPT Version :10

Sequence 1:NP_650813.2 Gene:Cpr92A / 42333 FlyBaseID:FBgn0038714 Length:245 Species:Drosophila melanogaster
Sequence 2:XP_551141.2 Gene:LOC3290497 / 3290497 VectorBaseID:AGAMI1_005151 Length:712 Species:Anopheles gambiae


Alignment Length:44 Identity:12/44 - (27%)
Similarity:18/44 - (40%) Gaps:5/44 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 VRPLTEAEAAMEVSAQPMDPFHRQLAVMSFVEGPSSSGTHPSPV 229
            |:..|.:..|:.|.|.|:  .|....|.:   .|.....|.:||
Mosquito    67 VKTTTYSHPAVAVHAAPV--VHSVPVVHA---APVVHSVHSAPV 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr92ANP_650813.2 Chitin_bind_4 68..120 CDD:459790
LOC3290497XP_551141.2 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.