DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr92A and Cpr62Ba

DIOPT Version :10

Sequence 1:NP_650813.2 Gene:Cpr92A / 42333 FlyBaseID:FBgn0038714 Length:245 Species:Drosophila melanogaster
Sequence 2:XP_565358.4 Gene:Cpr62Ba / 3290246 VectorBaseID:AGAMI1_002953 Length:144 Species:Anopheles gambiae


Alignment Length:97 Identity:31/97 - (31%)
Similarity:38/97 - (39%) Gaps:15/97 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 YSFGYDIQDGYTGDLKSQHETRHGDVVKGSYSVVDPDGTKRTVDYTADPHHGFNAVVRKEPLAYK 132
            |||.|.|....:|......|.|.||.|.|.|.|::|.|..|||.|..|...||..|::       
Mosquito    47 YSFRYYIDHPPSGVSFDHWENRKGDHVHGGYGVLEPGGFVRTVHYEVDGDSGFRTVIK------- 104

  Fly   133 APAHLAPVVAPAPA-PVPAHYGPAPAPPLPPV 163
                   ..||..: ....|.|....||..|:
Mosquito   105 -------TTAPGSSQQYNIHTGGKRTPPPQPL 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr92ANP_650813.2 Chitin_bind_4 68..120 CDD:459790 21/51 (41%)
Cpr62BaXP_565358.4 None

Return to query results.
Submit another query.