DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr92A and Cpr30F

DIOPT Version :9

Sequence 1:NP_650813.2 Gene:Cpr92A / 42333 FlyBaseID:FBgn0038714 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_723504.1 Gene:Cpr30F / 318997 FlyBaseID:FBgn0051876 Length:146 Species:Drosophila melanogaster


Alignment Length:186 Identity:70/186 - (37%)
Similarity:92/186 - (49%) Gaps:54/186 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ISLLSAMLGIAYAGVIGPGPYYGGPAGPGPLHHYGGYAPQHGPLPGPYVAP-----KPAAPEPYD 63
            :||.  :||:..|..|           ..|::|          .|...|.|     :..||..||
  Fly     5 VSLF--ILGVGAAAAI-----------ELPIYH----------SPAAIVKPLLKTVEVEAPAHYD 46

  Fly    64 PDPKYSFGYDIQDGYTGDLKSQHETRHGDVVKGSYSVVDPDGTKRTVDYTADPHHGFNAVVRKEP 128
                  |.|.:.|.:|||:|||.|:|.||.|:|.|::||.||..||||||:|.|:|||||||::|
  Fly    47 ------FAYSVHDEHTGDIKSQTESRKGDQVQGQYTLVDADGYLRTVDYTSDAHNGFNAVVRRDP 105

  Fly   129 LAYKA--PAHLAPVVAPAPAPVPAHYGP---APAPPLPPVPKAPLLSYPLALGPYH 179
            |..|.  .|.:|.::||||.|: |:..|   |||              .|.||.||
  Fly   106 LGQKVIKAAPIAKLLAPAPLPL-AYAAPKLLAPA--------------KLPLGLYH 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr92ANP_650813.2 PHA03185 <21..77 CDD:177553 11/60 (18%)
Chitin_bind_4 68..120 CDD:278791 28/51 (55%)
Cpr30FNP_723504.1 Chitin_bind_4 45..97 CDD:395303 30/57 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.