DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr92A and Cpr5C

DIOPT Version :9

Sequence 1:NP_650813.2 Gene:Cpr92A / 42333 FlyBaseID:FBgn0038714 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_572266.1 Gene:Cpr5C / 31510 FlyBaseID:FBgn0029811 Length:145 Species:Drosophila melanogaster


Alignment Length:163 Identity:70/163 - (42%)
Similarity:82/163 - (50%) Gaps:36/163 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KISLLSAMLGIAYAGVIGPGPYYGGPAGPGPLHHYGGYAPQHGPLPGPYVAPKPA---------- 57
            |...|.|::..|.|||:..|..|                  |......|.||.||          
  Fly     4 KFVALLALIAAASAGVLPAGQLY------------------HAAPVATYAAPAPAAVLKTVAQPV 50

  Fly    58 ---APEPYDPDPKYSFGYDIQDGYTGDLKSQHETRHGDVVKGSYSVVDPDGTKRTVDYTADPHHG 119
               |.|.|||.|:|.:.||:||..:||.|||.|.|.||||:|.||:||.||.||||.|||||.:|
  Fly    51 LAKADEEYDPHPQYKYAYDVQDAISGDSKSQVEERDGDVVRGEYSLVDSDGFKRTVQYTADPING 115

  Fly   120 FNAVVRKEPLAYKAPAHLAPVVAPAPAPVPAHY 152
            |||||.:|||.......:|||     |||.|.|
  Fly   116 FNAVVNREPLVKTVVKTVAPV-----APVYAAY 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr92ANP_650813.2 PHA03185 <21..77 CDD:177553 18/68 (26%)
Chitin_bind_4 68..120 CDD:278791 32/51 (63%)
Cpr5CNP_572266.1 Chitin_bind_4 64..116 CDD:278791 32/51 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D147941at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.