DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15025 and CG5509

DIOPT Version :9

Sequence 1:NP_650810.1 Gene:CG15025 / 42328 FlyBaseID:FBgn0038709 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_650204.1 Gene:CG5509 / 41539 FlyBaseID:FBgn0038054 Length:139 Species:Drosophila melanogaster


Alignment Length:154 Identity:38/154 - (24%)
Similarity:61/154 - (39%) Gaps:44/154 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 MSEHSMPNLVKPKRLKGKRKVLLATPAESRESEFLHRPGAPPDGDLVGDGVSPRLTQIDSTLCS- 250
            ||.:||..:    ....||.:   ...::|...||...|:    |......:.|:.|  |||.. 
  Fly     1 MSRYSMKGI----NFDVKRDI---QKVDARTYGFLKTKGS----DTPMPTAAKRINQ--STLIER 52

  Fly   251 ---------ISEEFQEP-------QLSFAERRKISQEGEYTIAKYGRKMSDVMMAAPNANQEVDD 299
                     :.||.|..       .:||..:||:....|:||.: |:|:||:..||        |
  Fly    53 LKSITLAEVVDEEDQSSTGSVESGSMSFEMKRKLFDAAEFTITR-GQKLSDLTHAA--------D 108

  Fly   300 KSVRYA-----KKASLEMERYMRS 318
            :.:.::     .|...|:|.|.|:
  Fly   109 EGINFSPYDTGNKTLEEIEEYCRA 132



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445413
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.