DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dys and CG5984

DIOPT Version :9

Sequence 1:NP_001036722.1 Gene:Dys / 42327 FlyBaseID:FBgn0260003 Length:3598 Species:Drosophila melanogaster
Sequence 2:NP_651548.1 Gene:CG5984 / 43281 FlyBaseID:FBgn0039500 Length:271 Species:Drosophila melanogaster


Alignment Length:296 Identity:59/296 - (19%)
Similarity:99/296 - (33%) Gaps:90/296 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly  1653 VRQRRARTPQSGESPSSAHTSSS----ESPTKG-----VENSPGAVGDQVMPDLLPPQTFRLAES 1708
            |.|......|:..|.|:..:|.|    .||.:|     .:.:|.|       |..|.::.|:..:
  Fly     4 VSQEMRLNTQAASSASACSSSGSGLEGNSPEEGGIFGRYQRTPDA-------DAYPSESPRVYVA 61

  Fly  1709 STLFS----QISLNPQKVTNTPPPKPAKTKRKAPSSPAQVVEIRVKNIQNDKMS-VQNIDLEPQQ 1768
            ..|..    |:...|........|.....||......   .|:||:......:. |:...|:|::
  Fly    62 PELTDAGKVQLLHFPSGAVRVNSPLGFIIKRNGVKGN---FEVRVEGPSGQPIQPVRQQQLDPER 123

  Fly  1769 GEI----------------VDTVNILESVEPFVPEYVETVQIVDLSE--------------DSDS 1803
            .:|                .::|.:..|  ||:     .|.|...:|              |||:
  Fly   124 FQIDCQLDAGAGLYKVHIKCNSVTLPRS--PFI-----IVAIAGATESIDGKPASSSVPISDSDA 181

  Fly  1804 SVRVDSQGKEMRRSKSKHSLNETPLPKVSDND--EDSAEQEEDLL-------RPSAENTSTPFLR 1859
            | ||.|:|           |..|.:..|..|:  .|..:...::|       |...|......|.
  Fly   182 S-RVQSRG-----------LGLTHVSLVERNEFTVDCGQAGSNMLLVGVLGQRGPCEEVVVRHLG 234

  Fly  1860 VEKRRISFDEKRKRVANERD---ILRDSEEEEPKTP 1892
            ....|:::     ||.:..|   :::..|:..|.:|
  Fly   235 RGIHRVTY-----RVCDPGDYILVVKWGEQHVPGSP 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DysNP_001036722.1 CH 13..111 CDD:278723
CH 129..225 CDD:278723
SPEC 312..525 CDD:238103
SbcC <325..957 CDD:223496
Smc <816..1591 CDD:224117
SPEC 1174..1365 CDD:238103
SPEC 1289..1485 CDD:295325
SPEC 2369..2576 CDD:238103
SPEC 2477..2714 CDD:238103
WW 2852..2882 CDD:238122
EF-hand_2 2883..2997 CDD:286194
EF-hand_3 3001..3100 CDD:286195
ZZ_dystrophin 3110..3158 CDD:239074
CG5984NP_651548.1 Filamin 65..154 CDD:279024 15/93 (16%)
Filamin 179..266 CDD:279024 23/104 (22%)
IG_FLMN 181..271 CDD:214720 21/102 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439913
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.