DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scsalpha2 and ACLB-2

DIOPT Version :9

Sequence 1:NP_650809.1 Gene:Scsalpha2 / 42326 FlyBaseID:FBgn0038708 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001332247.1 Gene:ACLB-2 / 835006 AraportID:AT5G49460 Length:608 Species:Arabidopsis thaliana


Alignment Length:284 Identity:87/284 - (30%)
Similarity:134/284 - (47%) Gaps:26/284 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 NIVGGVNP-KKG------GTEHLGKPVFKSVAEAVEKAKPDATVI--FIPPPSAAEGICAAI-ES 118
            ::.|.:|| .:|      |.|.:..||..:: ||...|.|.|.|.  |....|||....||: :.
plant    39 SVAGIINPGSEGFQKLFFGQEEIAIPVHAAI-EAACAAHPTADVFINFASFRSAAASSMAALKQP 102

  Fly   119 EIGLIVAITEGIPQADMVRISQMLNCQEKSRLLGPNCPGIISPDQCKIGIMPGDI--------HK 175
            .|.::..|.||:|::|..::........|. ::||...|.|.....|||...|.|        ::
plant   103 TIKVVAIIAEGVPESDTKQLIAYARANNKV-VIGPATVGGIQAGAFKIGDTAGTIDNIIQCKLYR 166

  Fly   176 RGVVGIVSRSGTLTYESVHQTTNVGLGQALCVGLGGDPFNGTSFIDALKVFLSDKEIKGIVMIGE 240
            .|.||.||:||.::.|..:....|..|....:.:|||.|.|::..|.:..|.:..:||.:|::||
plant   167 PGSVGFVSKSGGMSNEMYNTVARVTDGIYEGIAIGGDVFPGSTLSDHILRFNNIPQIKMMVVLGE 231

  Fly   241 IGGSAEEEAADFLKEKNTGCEAKPVVGFIAGQTAPPGR---RMGHAGAIISGGKGAAKDKVAALE 302
            :||..|....:.|||   |...||||.:::|..|...:   :.|||||...|...:|:.|..||.
plant   232 LGGRDEYSLVEALKE---GKVNKPVVAWVSGTCARLFKSEVQFGHAGAKSGGEMESAQAKNQALI 293

  Fly   303 KAGVRMTANPCHLGSTLLEEMIRL 326
            .||..:..:...|.|.:.|...:|
plant   294 DAGAIVPTSFEALESAIKETFEKL 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Scsalpha2NP_650809.1 PTZ00187 16..327 CDD:240307 87/284 (31%)
CoA_binding 36..129 CDD:280747 22/74 (30%)
Ligase_CoA 182..306 CDD:278948 43/126 (34%)
ACLB-2NP_001332247.1 PLN02522 1..608 CDD:178137 87/284 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.