DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scsalpha2 and suclg1

DIOPT Version :9

Sequence 1:NP_650809.1 Gene:Scsalpha2 / 42326 FlyBaseID:FBgn0038708 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001025589.1 Gene:suclg1 / 594977 XenbaseID:XB-GENE-478220 Length:325 Species:Xenopus tropicalis


Alignment Length:298 Identity:195/298 - (65%)
Similarity:243/298 - (81%) Gaps:0/298 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 NLKINKATKVLVQGFTGKQATFHSEESIKYGTNIVGGVNPKKGGTEHLGKPVFKSVAEAVEKAKP 96
            :|.|:|.|:|:.|||||||.||||:::::|||.:||||:|.|||:.|||.|||.|||||.|....
 Frog    28 HLYIDKDTRVICQGFTGKQGTFHSQQALEYGTKLVGGVSPGKGGSAHLGLPVFNSVAEAKEATGA 92

  Fly    97 DATVIFIPPPSAAEGICAAIESEIGLIVAITEGIPQADMVRISQMLNCQEKSRLLGPNCPGIISP 161
            .|:||::|||.||..|..||::||.|:|.|||||||.||||:...|..|..:||:||||||:|:|
 Frog    93 TASVIYVPPPFAAAAIHEAIDAEISLVVCITEGIPQQDMVRVKHRLLRQTTTRLIGPNCPGVINP 157

  Fly   162 DQCKIGIMPGDIHKRGVVGIVSRSGTLTYESVHQTTNVGLGQALCVGLGGDPFNGTSFIDALKVF 226
            .:||||||||.|||:|.:||||||||||||:|||||.|||||:||||:||||||||:|||.|.||
 Frog   158 GECKIGIMPGHIHKKGRIGIVSRSGTLTYEAVHQTTQVGLGQSLCVGIGGDPFNGTNFIDCLDVF 222

  Fly   227 LSDKEIKGIVMIGEIGGSAEEEAADFLKEKNTGCEAKPVVGFIAGQTAPPGRRMGHAGAIISGGK 291
            |||.:.:||::||||||||||.||:||:..|.|..|||||.||||.|||||||||||||||:|||
 Frog   223 LSDPKTEGIILIGEIGGSAEENAAEFLRTNNAGPNAKPVVSFIAGLTAPPGRRMGHAGAIIAGGK 287

  Fly   292 GAAKDKVAALEKAGVRMTANPCHLGSTLLEEMIRLKLV 329
            |.||:|:|||:||||.::.:|..||||:.:|..:.|::
 Frog   288 GGAKEKIAALQKAGVVVSMSPAQLGSTMHKEFEKRKML 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Scsalpha2NP_650809.1 PTZ00187 16..327 CDD:240307 194/294 (66%)
CoA_binding 36..129 CDD:280747 54/92 (59%)
Ligase_CoA 182..306 CDD:278948 95/123 (77%)
suclg1NP_001025589.1 PTZ00187 3..323 CDD:240307 194/294 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60703
OrthoDB 1 1.010 - - D1247548at2759
OrthoFinder 1 1.000 - - FOG0002539
OrthoInspector 1 1.000 - - otm49107
Panther 1 1.100 - - O PTHR11117
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1662
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.030

Return to query results.
Submit another query.