DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31221 and egg-2

DIOPT Version :10

Sequence 1:NP_001262729.1 Gene:CG31221 / 42325 FlyBaseID:FBgn0051221 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_498537.1 Gene:egg-2 / 187510 WormBaseID:WBGene00019811 Length:548 Species:Caenorhabditis elegans


Alignment Length:57 Identity:23/57 - (40%)
Similarity:26/57 - (45%) Gaps:6/57 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 CHPYEPFKCPGDG----NCISIQYLCDGAPDCSDGYDEDMRLCTAAKRPPVEETASF 116
            |.|...|.||..|    .||....:|||..||.||.||  :.||..|...||.:..|
 Worm   371 CDPKHTFTCPAVGGIHNKCIKRSKVCDGIFDCEDGADE--KKCTPVKECVVESSIQF 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31221NP_001262729.1 LDLa 64..97 CDD:197566 15/36 (42%)
egg-2NP_498537.1 LDLa 123..159 CDD:238060
LDLa 216..251 CDD:238060
LDLa 254..287 CDD:238060
LDLa 300..327 CDD:238060
LDLa 373..411 CDD:238060 16/39 (41%)
LDLa 424..453 CDD:238060 1/2 (50%)
LDLa 456..491 CDD:238060
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.