DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31221 and F58H1.7

DIOPT Version :9

Sequence 1:NP_001262729.1 Gene:CG31221 / 42325 FlyBaseID:FBgn0051221 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001041139.1 Gene:F58H1.7 / 179636 WormBaseID:WBGene00010290 Length:185 Species:Caenorhabditis elegans


Alignment Length:154 Identity:72/154 - (46%)
Similarity:104/154 - (67%) Gaps:6/154 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 CHPYEPFKCPGDGNCISIQYLCDGAPDCSDGYDEDMRLCTAAKRPPVEETASFLQSLIASHGPNY 128
            |..:.||.|| .|.|:.|:|||||:|||||.|||:..:||||.|||||||.:||::|:::||.::
 Worm    37 CPTWHPFACP-SGECVPIKYLCDGSPDCSDEYDENKSMCTAATRPPVEETQAFLKALMSAHGKDF 100

  Fly   129 LEKLFGSKARDALSPLGGVEKVAIALSESQTIEDFGAALHLMRSDLEHLRSVFMAVENGDLGMLK 193
            |.|:||.||:..||.:|||:|||:|||::.|.:.|.:.:.|...:.:|:..|...:.||....|.
 Worm   101 LVKVFGPKAKAELSGMGGVDKVAVALSQTPTADLFASEMKLDDGETQHMLEVMEGILNGSTDELT 165

  Fly   194 SLGIKDSELGDVKFFLEKLVNTGF 217
            |     :|..|.:||::||..|||
 Worm   166 S-----NEAADFRFFVQKLQETGF 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31221NP_001262729.1 LDLa 64..97 CDD:197566 19/32 (59%)
F58H1.7NP_001041139.1 LDLa 43..69 CDD:197566 17/26 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160161
Domainoid 1 1.000 101 1.000 Domainoid score I4350
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H15043
Inparanoid 1 1.050 150 1.000 Inparanoid score I2969
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG28591
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016572
OrthoInspector 1 1.000 - - oto20345
orthoMCL 1 0.900 - - OOG6_114011
Panther 1 1.100 - - LDO PTHR20967
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16962
SonicParanoid 1 1.000 - - X13467
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1413.930

Return to query results.
Submit another query.