DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5316 and APTX

DIOPT Version :9

Sequence 1:NP_650805.1 Gene:CG5316 / 42322 FlyBaseID:FBgn0038704 Length:662 Species:Drosophila melanogaster
Sequence 2:XP_016870320.1 Gene:APTX / 54840 HGNCID:15984 Length:423 Species:Homo sapiens


Alignment Length:95 Identity:36/95 - (37%)
Similarity:53/95 - (55%) Gaps:1/95 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 WSSALIKDISKPENLIISSEIAVVIADKFPKAQHHYLVLPLADIPSIFHLNRSHLSLLEELHLLA 67
            ||..|...:..|:..:...|..|||.||:|||::|:||||...|.|:..:.|.||.||:.:|.:.
Human   181 WSQGLKISMQDPKMQVYKDEQVVVIKDKYPKARYHWLVLPWTSISSLKAVAREHLELLKHMHTVG 245

  Fly    68 RNV-VEVKGVRWQDFNVGFHAEPSMQRLHL 96
            ..| |:..|.....|.:|:||.|||..:.:
Human   246 EKVIVDFAGSSKLRFRLGYHAIPSMSSIRV 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5316NP_650805.1 DcpS_C 8..100 CDD:288796 33/90 (37%)
zf-C2HE 119..179 CDD:292895
DcpS_C 235..326 CDD:288796
zf-C2HE 345..405 CDD:292895
APTXXP_016870320.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157344
Domainoid 1 1.000 91 1.000 Domainoid score I7762
eggNOG 1 0.900 - - E1_KOG0562
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 1 Normalized mean entropy S3909
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1290702at2759
OrthoFinder 1 1.000 - - FOG0003607
OrthoInspector 1 1.000 - - oto89900
orthoMCL 1 0.900 - - OOG6_103324
Panther 1 1.100 - - LDO PTHR12486
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R76
SonicParanoid 1 1.000 - - X4024
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1211.730

Return to query results.
Submit another query.