DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5316 and CG34015

DIOPT Version :9

Sequence 1:NP_650805.1 Gene:CG5316 / 42322 FlyBaseID:FBgn0038704 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_001033848.1 Gene:CG34015 / 3885570 FlyBaseID:FBgn0054015 Length:139 Species:Drosophila melanogaster


Alignment Length:136 Identity:41/136 - (30%)
Similarity:67/136 - (49%) Gaps:13/136 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LIKDISKPENLI-ISSEIAVVIADKFPKAQHHYLVLPLADIPSIFHLNRSHLSLLEELHLLARNV 70
            ||.|...|..:: :.::..|:..|..|.:|||||.:......|:..||:||.||::.:....:::
  Fly    10 LISDGRIPSTVLEVENDDFVIFQDIKPASQHHYLAVTKKHYASLKDLNKSHDSLVQLMENALKDL 74

  Fly    71 VEVKGVRWQDFNVGFHAEP--SMQRLHLHVIS----KDFVSTSLKTKKHWNSFNTELFVPYTKLY 129
            :..|||...|...|||..|  :::.||:|.||    ..|:|..:.....|  |.|   |...::|
  Fly    75 LVSKGVSVDDALFGFHLPPFITVKHLHMHAISPRTQMTFLSKMIFRPSVW--FKT---VDEARIY 134

  Fly   130 AQLEKE 135
            .. :||
  Fly   135 LS-QKE 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5316NP_650805.1 DcpS_C 8..100 CDD:288796 29/94 (31%)
zf-C2HE 119..179 CDD:292895 5/17 (29%)
DcpS_C 235..326 CDD:288796
zf-C2HE 345..405 CDD:292895
CG34015NP_001033848.1 HIT_like 5..106 CDD:294158 30/95 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464148
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12486
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.