DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5316 and Aptx

DIOPT Version :9

Sequence 1:NP_650805.1 Gene:CG5316 / 42322 FlyBaseID:FBgn0038704 Length:662 Species:Drosophila melanogaster
Sequence 2:XP_017448660.1 Gene:Aptx / 259271 RGDID:628740 Length:343 Species:Rattus norvegicus


Alignment Length:178 Identity:72/178 - (40%)
Similarity:104/178 - (58%) Gaps:9/178 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 WSSALIKDISKPENLIISSEIAVVIADKFPKAQHHYLVLPLADIPSIFHLNRSHLSLLEELHLLA 67
            ||..|...:..|:..:...:..|||.||:|||:||:||||.|.|.|:..:...||.||:.:|.:.
  Rat   168 WSQGLKISMKDPKMQVYKDDQVVVIKDKYPKARHHWLVLPWASISSLKVVTSEHLELLKHMHAVG 232

  Fly    68 RNVV-EVKGVRWQDFNVGFHAEPSMQRLHLHVISKDFVSTSLKTKKHWNSFNTELFVPYTKLYAQ 131
            ..|: :..|.....|.:|:||.|||..:||||||:||.|..||.||||||||||.|:....:...
  Rat   233 EKVIADFTGSSKLRFRLGYHAIPSMSHVHLHVISQDFDSPCLKNKKHWNSFNTEYFLESQAVIKM 297

  Fly   132 LEKENSISRLPKSLKD---ELLAKPLICNQCEFVARNLPSLKGHLVGH 176
            :::...:     ::||   |||..||.|::|:.:..::|.||.||..|
  Rat   298 VQEAGRV-----TVKDGTCELLKLPLRCHECQQLLPSIPQLKEHLRKH 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5316NP_650805.1 DcpS_C 8..100 CDD:288796 36/92 (39%)
zf-C2HE 119..179 CDD:292895 18/61 (30%)
DcpS_C 235..326 CDD:288796
zf-C2HE 345..405 CDD:292895
AptxXP_017448660.1 FHA <38..112 CDD:238017
aprataxin_related 165..266 CDD:238609 39/97 (40%)
zf-C2HE 285..341 CDD:292895 18/61 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351312
Domainoid 1 1.000 91 1.000 Domainoid score I7573
eggNOG 1 0.900 - - E1_KOG0562
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1290702at2759
OrthoFinder 1 1.000 - - FOG0003607
OrthoInspector 1 1.000 - - oto97016
orthoMCL 1 0.900 - - OOG6_103324
Panther 1 1.100 - - LDO PTHR12486
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4024
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.750

Return to query results.
Submit another query.