DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dl and DLK2

DIOPT Version :9

Sequence 1:NP_001247193.1 Gene:Dl / 42313 FlyBaseID:FBgn0000463 Length:833 Species:Drosophila melanogaster
Sequence 2:XP_005249365.1 Gene:DLK2 / 65989 HGNCID:21113 Length:476 Species:Homo sapiens


Alignment Length:465 Identity:128/465 - (27%)
Similarity:180/465 - (38%) Gaps:164/465 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 SGCAKFCRPRDDSFGHSTCSETGEIICLTGWQGDYCHIPKCAKGCE--HGHCDKPNQCVCQLGWK 253
            |||.  |.       |..|     ::|:.|..|.......|:..|:  ||.|.....|.|..||:
Human    96 SGCR--CL-------HLVC-----LLCILGAPGQPVRADDCSSHCDLAHGCCAPDGSCRCDPGWE 146

  Fly   254 GALCNECVLEPNCIHGTCNKPWTCICNEGWGGLYCNQDLNYCTNHRPCKNGGTCFNTGEGLYTCK 318
            |..|..||..|.|.||||::||.|||:.||.|.:|::|.:.||...||:|||.|...|.|.|.|.
Human   147 GLHCERCVRMPGCQHGTCHQPWQCICHSGWAGKFCDKDEHICTTQSPCQNGGQCMYDGGGEYHCV 211

  Fly   319 CAPGYSGDDCENEIYSCDADVNPCQNGGTCIDEPHTKTGYKCHCANGWSGKMCEEKVLTCSDKPC 383
            |.||:.|.|||.:...|:...:||:|||.|.|:                                
Human   212 CLPGFHGRDCERKAGPCEQAGSPCRNGGQCQDD-------------------------------- 244

  Fly   384 HQGICRNVRPGLGSKGQGYQCECPIGYSGPNCDLQLDNCSPNPCINGGSCQPSGKCICPAGFSGT 448
             ||...|           :.|.|.:                                   ||.|.
Human   245 -QGFALN-----------FTCRCLV-----------------------------------GFVGA 262

  Fly   449 RCETNIDDCLGHQCENGGTCIDMVNQYRCQCVPGFHGTHCSSKVDLCLIRPCANGGTCLNLNNDY 513
            |||.|:||                                      ||:||||||.|||:..|.:
Human   263 RCEVNVDD--------------------------------------CLMRPCANGATCLDGINRF 289

  Fly   514 QCTCRAGFTGKDCSVDIDECSSGPCHNGGTCMNRVNSFECVCANGFRGKQCD--------EESYD 570
            .|.|..||.|:.|::::|:|:|.||..|..|.:||:.|:|:|.:|:.||.|:        ..:.|
Human   290 SCLCPEGFAGRFCTINLDDCASRPCQRGARCRDRVHDFDCLCPSGYGGKTCELVLPVPDPPTTVD 354

  Fly   571 -------SVTFDA-----HQYGA---------TTQARADGLTNAQVVLIAVFSVAMPLVAVIAAC 614
                   :|...|     |..||         ..:.:..||....:|.:.||...  ..|::.|.
Human   355 TPLGPTSAVVVPATGPAPHSAGAGLLRISVKEVVRRQEAGLGEPSLVALVVFGAL--TAALVLAT 417

  Fly   615 VVFCMKRKRK 624
            |:..::..|:
Human   418 VLLTLRAWRR 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DlNP_001247193.1 MNNL 23..96 CDD:284966
DSL 164..226 CDD:279722 9/34 (26%)
EGF_CA 291..329 CDD:238011 18/37 (49%)
EGF_CA 337..372 CDD:238011 7/34 (21%)
EGF_CA 453..488 CDD:238011 3/34 (9%)
EGF_CA 492..526 CDD:238011 17/33 (52%)
EGF_CA 529..564 CDD:238011 15/34 (44%)
DLK2XP_005249365.1 EGF_CA 182..222 CDD:238011 18/39 (46%)
EGF_CA 267..303 CDD:238011 20/73 (27%)
EGF_CA 305..341 CDD:238011 15/35 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24044
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.