DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dl and crb

DIOPT Version :9

Sequence 1:NP_001247193.1 Gene:Dl / 42313 FlyBaseID:FBgn0000463 Length:833 Species:Drosophila melanogaster
Sequence 2:NP_001247284.1 Gene:crb / 42896 FlyBaseID:FBgn0259685 Length:2253 Species:Drosophila melanogaster


Alignment Length:545 Identity:158/545 - (28%)
Similarity:221/545 - (40%) Gaps:189/545 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 CDLNYYGSGCAKFCRPRDDSFGHSTCSETGEIICLTGWQGDYCHIP------KCAKGCEHGHC-D 241
            ||.|...:|...|     |::|..||.      ||.||.|:.|..|      :|..|   |.| |
  Fly   429 CDKNPCLNGGRCF-----DTYGWYTCQ------CLDGWGGEICDRPMTCQTQQCLNG---GTCLD 479

  Fly   242 KP--NQCVCQLGWKGALC------------------NECVLEP---------------------- 264
            ||  .||:|...:.|.||                  .:||.:|                      
  Fly   480 KPIGFQCLCPPEYTGELCQIAPSCAQQCPIDSECVGGKCVCKPGSSGPIGHCLPTTTTPTPEQEP 544

  Fly   265 ----------------------------------------------------------------N 265
                                                                            |
  Fly   545 TTTPRTTPNPNPAIPNTLTTTTKIPPITTSRTLVGTTTGSRRPPQQPLQSPTQRSASLNACPQEN 609

  Fly   266 CIH-GTC---NKPWTCICNEGWGGLYCNQD------------LNYCTNHRPCKNGGTCFNTGEGL 314
            |:: |||   :..::|||..|:.|..|...            :|....:..|.|||||...|.  
  Fly   610 CLNGGTCLGYSGNYSCICASGYTGYNCQTSTGDGASALALTPINCNATNGKCLNGGTCSMNGT-- 672

  Fly   315 YTCKCAPGYSGDDC-------------------------ENEIYSCD-ADVNPCQNGGTCIDEPH 353
             .|.||.|||||.|                         ||::  |: ....||||||.|:|.|:
  Fly   673 -HCYCAVGYSGDRCEKAENCSPLNCQEPMVCVQNQCLCPENKV--CNQCATQPCQNGGECVDLPN 734

  Fly   354 TKTGYKCHCANGWSGKMCEEKVLTCSDKP--CHQGICRNVRPGLGSKGQGYQCECPIGYSGPNCD 416
              ..|:|.|..||:|:.|...|..|:..|  |..|||:|      .|| .|:|.|..|::|.:||
  Fly   735 --GDYECKCTRGWTGRTCGNDVDECTLHPKICGNGICKN------EKG-SYKCYCTPGFTGVHCD 790

  Fly   417 LQLDNCSPNPCINGGSCQ---PSGKCICPAGFSGTRCETNIDDCLGHQCENGGTCIDMVNQYRCQ 478
            ..:|.|...||:||.:|.   .:.:|:|..|:.|..||.:||:|..:.|.||.||||.:|.:.|.
  Fly   791 SDVDECLSFPCLNGATCHNKINAYECVCQPGYEGENCEVDIDECGSNPCSNGSTCIDRINNFTCN 855

  Fly   479 CVPGFHGTHCSSKVDLCLIRPCANGGTCLNLNNDYQCTCR-AGFTGKDCSVDIDECSSGPCHNGG 542
            |:||..|..|...:|.|:..||.|||.|::....::|.|. .|:.|::|.::||||.|.||.||.
  Fly   856 CIPGMTGRICDIDIDDCVGDPCLNGGQCIDQLGGFRCDCSGTGYEGENCELNIDECLSNPCTNGA 920

  Fly   543 TCMNRVNSFECVCANGFRGKQCDEE 567
            .|::||..:.|.|.||::||.|:::
  Fly   921 KCLDRVKDYFCDCHNGYKGKNCEQD 945

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DlNP_001247193.1 MNNL 23..96 CDD:284966
DSL 164..226 CDD:279722 14/41 (34%)
EGF_CA 291..329 CDD:238011 17/74 (23%)
EGF_CA 337..372 CDD:238011 15/34 (44%)
EGF_CA 453..488 CDD:238011 16/34 (47%)
EGF_CA 492..526 CDD:238011 12/34 (35%)
EGF_CA 529..564 CDD:238011 18/34 (53%)
crbNP_001247284.1 LamG 91..228 CDD:238058
EGF_CA 386..423 CDD:238011
EGF_CA 425..460 CDD:238011 14/41 (34%)
EGF 466..495 CDD:278437 10/31 (32%)
EGF 605..633 CDD:278437 9/27 (33%)
EGF_CA 716..750 CDD:238011 15/35 (43%)
EGF_CA 753..789 CDD:238011 15/42 (36%)
EGF_CA 792..828 CDD:238011 11/35 (31%)
EGF_CA 830..865 CDD:238011 16/34 (47%)
EGF_CA 868..905 CDD:238011 12/36 (33%)
EGF_CA 907..943 CDD:238011 18/35 (51%)
EGF_CA 1009..1045 CDD:238011
EGF_CA 1047..1082 CDD:238011
Laminin_G_1 1155..1290 CDD:278483
EGF 1316..1346 CDD:278437
Laminin_G_1 1388..1550 CDD:278483
EGF_CA <1593..1622 CDD:238011
Laminin_G_2 1692..1828 CDD:280389
EGF_CA 1901..1937 CDD:238011
EGF_CA 1939..1974 CDD:238011
EGF_CA 2057..2094 CDD:238011
EGF_CA 2096..2133 CDD:238011
EGF_CA 2137..2175 CDD:238011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I11640
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24044
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.