DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dl and sdz-23

DIOPT Version :9

Sequence 1:NP_001247193.1 Gene:Dl / 42313 FlyBaseID:FBgn0000463 Length:833 Species:Drosophila melanogaster
Sequence 2:NP_505091.1 Gene:sdz-23 / 186544 WormBaseID:WBGene00019066 Length:267 Species:Caenorhabditis elegans


Alignment Length:246 Identity:60/246 - (24%)
Similarity:96/246 - (39%) Gaps:74/246 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   412 GPNCDLQLD-------------NCSPNPCINGGSCQP----SGKCICPAGFSGTRCETNIDDCLG 459
            |.:.||||.             :.||.| |...|.|.    :|..|  :|....|....::|...
 Worm    50 GISLDLQLQPNIPKEFVLPMPTSSSPIP-IFDYSIQTLSLITGNII--SGKKNVRLPLLVNDPWV 111

  Fly   460 HQC---ENGGTCIDMVNQYRCQCVPGFHGTHCSSKVDLCLIRPCANGGTCLNLNNDYQCTCRAGF 521
            |:.   |||   :.:....|.:|:|.|:|..|                       .|.||     
 Worm   112 HKTISNENG---VSVFTSIRFECLPSFYGPKC-----------------------QYYCT----- 145

  Fly   522 TGKDCSVDIDECSSGPCHNGGTCMNRVNSFECVCANGFRGKQCDEESYDSVTFDAHQYGATTQAR 586
            :|:.||  .|||....|.|...|....:..:|||.:|:.|:.|:   .|...|: |.        
 Worm   146 SGEKCS--RDECPKRKCQNNSQCQFDGSESKCVCQSGYIGEFCE---IDQTVFN-HP-------- 196

  Fly   587 ADGLTNAQVVLIAVFSVAMPLVAVIAACVVFCMKRKRKRAQEKDDAEARKQ 637
            ||   :|.|::.::..::: .:.:||..|:  ||:||:...|..:....|:
 Worm   197 AD---SAVVLMCSIVFLSL-FIIIIAVMVI--MKQKRRTITEPTNLSTGKE 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DlNP_001247193.1 MNNL 23..96 CDD:284966
DSL 164..226 CDD:279722
EGF_CA 291..329 CDD:238011
EGF_CA 337..372 CDD:238011
EGF_CA 453..488 CDD:238011 10/37 (27%)
EGF_CA 492..526 CDD:238011 4/33 (12%)
EGF_CA 529..564 CDD:238011 11/34 (32%)
sdz-23NP_505091.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.