DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dl and arg-1

DIOPT Version :9

Sequence 1:NP_001247193.1 Gene:Dl / 42313 FlyBaseID:FBgn0000463 Length:833 Species:Drosophila melanogaster
Sequence 2:NP_001024615.1 Gene:arg-1 / 180501 WormBaseID:WBGene00000185 Length:357 Species:Caenorhabditis elegans


Alignment Length:216 Identity:73/216 - (33%)
Similarity:94/216 - (43%) Gaps:34/216 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   406 CPIGYSGPNCDLQLDNCSPNPCINGGSCQPSGKCICPAGFSGTRCETNIDDCLGHQ--CENGGTC 468
            |...|.|..|:..   |.|:|.:: ..|..:|...|..|:.|..|.:||..| .||  |.|||.|
 Worm   131 CTSNYYGKRCNRY---CIPSPALH-WECSTNGVRQCAVGWYGDDCSSNIKFC-SHQNPCANGGVC 190

  Fly   469 IDMVNQYRCQCVPGFHGTHCS---SKVDLCLIRPCANGGTCLNLN-NDYQCTCRAGFTGKDCSVD 529
               ...|:|||...|.|..|.   |||...|.|.|.:||||:::| .:.||.|..||.|..|.:.
 Worm   191 ---STDYKCQCPSEFLGPRCETPVSKVHCTLERVCKHGGTCVSVNRTNVQCKCIRGFLGSLCEIG 252

  Fly   530 I-DECSSGPCHNGGTCMNRVNSFECVCANGFRGKQCDEESYDSVTFDAHQYGATTQARADGLTNA 593
            | ..||:..|....||..|. || .|||.       .|:|.::|          |....|.|..|
 Worm   253 IHGNCSAMRCSVDETCQIRA-SF-AVCAK-------KEKSAETV----------TGTGPDALHFA 298

  Fly   594 QVVLIAVFSVAMPLVAVIAAC 614
            .:.:|.||.....|..|.:.|
 Worm   299 MLAVIGVFVCVAGLALVASKC 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DlNP_001247193.1 MNNL 23..96 CDD:284966
DSL 164..226 CDD:279722
EGF_CA 291..329 CDD:238011
EGF_CA 337..372 CDD:238011
EGF_CA 453..488 CDD:238011 16/36 (44%)
EGF_CA 492..526 CDD:238011 15/34 (44%)
EGF_CA 529..564 CDD:238011 12/35 (34%)
arg-1NP_001024615.1 DSL 107..171 CDD:128366 12/43 (28%)
EGF_CA 174..208 CDD:238011 16/37 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D197806at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.