DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dl and glp-1

DIOPT Version :9

Sequence 1:NP_001247193.1 Gene:Dl / 42313 FlyBaseID:FBgn0000463 Length:833 Species:Drosophila melanogaster
Sequence 2:NP_499014.1 Gene:glp-1 / 176286 WormBaseID:WBGene00001609 Length:1295 Species:Caenorhabditis elegans


Alignment Length:469 Identity:149/469 - (31%)
Similarity:197/469 - (42%) Gaps:114/469 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 CDLNYYGSGCAK-----------------FCRPRDDSFGHSTCSETGEIICLTGWQGDYCH--IP 229
            |:..|.|..|..                 .|.|   .:|...|      ||..|:.|.||.  |.
 Worm   101 CEEGYGGPDCKTPLFSGVNPCDSDPCNNGLCYP---FYGGFQC------ICNNGYGGSYCEEGID 156

  Fly   230 KCAKG-CEHG----------HCDKPNQCVCQLGWKGALC--NECVLEPN-CIHGTC------NKP 274
            .||:. |..|          :||      |.:|..|..|  .||.|..| |.||.|      :|.
 Worm   157 HCAQNECAEGSTCVNSVYNYYCD------CPIGKSGRYCERTECALMGNICNHGRCIPNRDEDKN 215

  Fly   275 WTCICNEGWGGLYCNQDLNYCTNHRPCKNGGTCFNTGEGLYTCKCAPGYSGDDCENEIYSCDADV 339
            :.|:|:.|:.|.:||:|.|.|.....|.|..||||. .|.:||.|.|||:|..||..|..|...|
 Worm   216 FRCVCDSGYEGEFCNKDKNECLIEETCVNNSTCFNL-HGDFTCTCKPGYAGKYCEEAIDMCKDYV 279

  Fly   340 NPCQNGGTCIDEPHTKTGYKCHCANGWSGKMCEEKVLTCSDKPCHQGICRNVRPGLGSKGQGYQC 404
              |||.|.|..:.:...  .|:|..|::|:.||                               .
 Worm   280 --CQNDGYCAHDSNQMP--ICYCEQGFTGQRCE-------------------------------I 309

  Fly   405 ECPIGYSGPNCDLQLD--NCSPN--PCINGGSCQPSGKCICPAGFSGTRCETN--------IDDC 457
            |||.|:.|.:|||.|.  :||.:  .|.|.|.| .:|.|:|...:.|.|||.|        |..|
 Worm   310 ECPSGFGGIHCDLPLQRPHCSRSNGTCYNDGRC-INGFCVCEPDYIGDRCEINRKDFKFPDIQSC 373

  Fly   458 LGHQCENGGTCIDMVNQ-YRCQCVPGFHGTHCSSKVDLCLIRPCANGGTCLNLNNDYQCTCRAGF 521
            ..:.|.|..||||:.|. |.|.|..||:|.:|...: ||....|||||||..:|...:|.|..||
 Worm   374 KYNPCVNNATCIDLKNSGYSCHCPLGFYGLNCEQHL-LCTPTTCANGGTCEGVNGVIRCNCPNGF 437

  Fly   522 TGKDCSV-DIDECSSGPCHNGGTCMNRVNSFECVCANGFRGKQCD-----EESYDSVTFDAHQYG 580
            :|..|.: |...||..||.|||.|.   |:..|.|..|:.|..|:     |:|.::|..|..:..
 Worm   438 SGDYCEIKDRQLCSRHPCKNGGVCK---NTGYCECQYGYTGPTCEEVLVIEKSKETVIRDLCEQR 499

  Fly   581 ATTQARADGLTNAQ 594
            ......::|:.|.:
 Worm   500 KCMDLASNGICNPE 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DlNP_001247193.1 MNNL 23..96 CDD:284966
DSL 164..226 CDD:279722 12/58 (21%)
EGF_CA 291..329 CDD:238011 17/37 (46%)
EGF_CA 337..372 CDD:238011 10/34 (29%)
EGF_CA 453..488 CDD:238011 16/43 (37%)
EGF_CA 492..526 CDD:238011 15/33 (45%)
EGF_CA 529..564 CDD:238011 14/34 (41%)
glp-1NP_499014.1 EGF_CA 118..152 CDD:238011 9/42 (21%)
EGF_CA 155..190 CDD:238011 10/40 (25%)
EGF_CA 232..269 CDD:238011 17/37 (46%)
EGF_CA 369..406 CDD:238011 15/36 (42%)
EGF_CA 451..479 CDD:238011 12/30 (40%)
NL 489..526 CDD:197463 4/25 (16%)
Notch 533..568 CDD:278494
Notch 573..608 CDD:278494
NOD 612..661 CDD:284282
NODP 698..755 CDD:284987
ANK repeat 921..959 CDD:293786
ANK 926..1054 CDD:238125
Ank_5 949..1002 CDD:290568
ANK 956..1127 CDD:238125
ANK repeat 961..992 CDD:293786
ANK repeat 994..1028 CDD:293786
Ank_2 999..1105 CDD:289560
ANK repeat 1030..1061 CDD:293786
ANK repeat 1071..1105 CDD:293786
Ank_2 1079..1171 CDD:289560
ANK repeat 1107..1138 CDD:293786
ANK repeat 1140..1170 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.