DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dl and F55H12.3

DIOPT Version :9

Sequence 1:NP_001247193.1 Gene:Dl / 42313 FlyBaseID:FBgn0000463 Length:833 Species:Drosophila melanogaster
Sequence 2:NP_492397.4 Gene:F55H12.3 / 172702 WormBaseID:WBGene00010134 Length:2957 Species:Caenorhabditis elegans


Alignment Length:551 Identity:150/551 - (27%)
Similarity:218/551 - (39%) Gaps:165/551 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 CDLNYYGSGCAKFCRPRDDSFGHSTCSETGEIICLTGWQGDYCHIPK-CAKG------CEH-GHC 240
            ||..|.|..| :|..|...  |.:.|      ||...|.|..|.:.| |..|      |:: |.|
 Worm  1503 CDFCYGGENC-EFLNPPYQ--GGAWC------ICAQDWYGRQCDVSKFCFNGTNDNYICQNGGRC 1558

  Fly   241 DKP-NQCVCQLGWKGALC------NECVL-EPNCIHGTCNK-----------------------P 274
            :|. ..|.|...:.||.|      :.|.| |.:|:.|.|.:                       .
 Worm  1559 NKDLRLCECLSSFTGAFCETAIDESNCALDEKDCVFGLCRRENAQVYCNCYDGYMKDSLGNCTLA 1623

  Fly   275 W------------------------TCIC-NEGWGG------------LYCNQDL---------- 292
            |                        .|.| :.||.|            |||...:          
 Worm  1624 WDMCSLNNPCQQNGYCNFNQNIGDEICDCTSSGWLGDHCEIQPKLDNCLYCQNSVKCFDTFTNYS 1688

  Fly   293 ----------NYCTN------HRPCKNGGTC----FNTGEGL----YTCKCAPGYSGDDCENEIY 333
                      :||::      ..||.|||||    :||...:    |.|.|..||.|.:||:.|:
 Worm  1689 RCQCAPGFSGDYCSDLIDDCFFEPCFNGGTCSIFNYNTTTKVSIESYNCTCQTGYFGTNCESRIH 1753

  Fly   334 SCDADVNPCQNGGTCIDEPHTKTGYK---CHCANGWSGKMCEEKVLTCSDKPCHQGICRNVRPGL 395
            ....|:..|||||||     ..|.:.   |.|.:.:.|..||:   :||::..|...|:.     
 Worm  1754 PSCTDLITCQNGGTC-----QLTSFDTAVCQCTDQFYGIYCEK---SCSEQCVHSSGCKQ----- 1805

  Fly   396 GSKGQGYQCECPIGYSGPNCDLQLDNCSPN--PCINGGSCQPSGK-CICPAGFSGTRCETNIDDC 457
            .|.|..: |||..|::...||...|.|..|  .|.|.|:|..:.: |.|...||||.||.|.:.|
 Worm  1806 SSNGTVF-CECYDGFTSTRCDEVCDVCKANILLCQNSGTCNSTTQSCDCIDYFSGTYCERNENLC 1869

  Fly   458 LGH--QCENGGTCIDMVNQYRCQCVPGFHGTHCSSKVDLCLIRPCANGGTCLNLNNDYQCTC--- 517
            ..:  .|:|||||.....  .|.|:|.:.|.:|.:::..|....|.|||||:    ||..||   
 Worm  1870 ETNLVVCKNGGTCNPKTG--LCVCLPDYTGDYCDNQIHSCSDINCFNGGTCI----DYNATCACL 1928

  Fly   518 ------RAGFTGKDCSVDIDECSSGP-CHNGGTCMNRVNSFECVCA-NGFRGKQCD-EESYD-SV 572
                  |..:.|:.|::.:...::.| |.|.|.|::..|...|.|: ..|.|::|: ..|:: ::
 Worm  1929 PGTTGDRCQYLGQPCTIYLPNGTATPYCLNEGKCLDLPNGAACDCSGTNFIGRRCETSSSFNFNL 1993

  Fly   573 TFDAHQYGATTQARADGLTNAQVVLIAVFSV 603
            .|:...|   |.....||.:.  ::||.|:|
 Worm  1994 VFNGMSY---TPDIVTGLFSN--LIIAQFTV 2019

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DlNP_001247193.1 MNNL 23..96 CDD:284966
DSL 164..226 CDD:279722 13/41 (32%)
EGF_CA 291..329 CDD:238011 17/71 (24%)
EGF_CA 337..372 CDD:238011 12/37 (32%)
EGF_CA 453..488 CDD:238011 12/36 (33%)
EGF_CA 492..526 CDD:238011 13/42 (31%)
EGF_CA 529..564 CDD:238011 10/36 (28%)
F55H12.3NP_492397.4 LDLa 185..217 CDD:238060
CCP 604..651 CDD:214478
EGF_CA 851..884 CDD:214542
CCP <1066..1110 CDD:153056
EGF_2 1831..1862 CDD:285248 12/30 (40%)
EGF_2 1869..1900 CDD:285248 11/32 (34%)
HYR 2235..2315 CDD:280629
TNFRSF 2510..2657 CDD:304602
GCC2_GCC3 2517..2567 CDD:285001
CRD2 2530..2590 CDD:276900
GCC2_GCC3 <2640..2676 CDD:285001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166870
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.