DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dl and Dll3

DIOPT Version :9

Sequence 1:NP_001247193.1 Gene:Dl / 42313 FlyBaseID:FBgn0000463 Length:833 Species:Drosophila melanogaster
Sequence 2:NP_031892.2 Gene:Dll3 / 13389 MGIID:1096877 Length:585 Species:Mus musculus


Alignment Length:544 Identity:168/544 - (30%)
Similarity:233/544 - (42%) Gaps:118/544 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLTAFICFTVIVQVHSSGSFELRLKYFSNDHGRDNEGRCCSGESDGATGKCLGSCKTRFRVCLKH 71
            |:.||:    :.|...:|.|||::..|....|.......|:..         |.|:..||||||.
Mouse    13 LILAFL----LPQALPAGVFELQIHSFGPGPGLGTPRSPCNAR---------GPCRLFFRVCLKP 64

  Fly    72 YQATIDTTSQCTYGDVIT---PILGEN------SVNLTDAQRFQNKGFTNPIQFPFSFSWPGTFS 127
            ..:...|.|.|..|..::   |:..|:      ::.|.|..          ::.||..:||||||
Mouse    65 GVSQEATESLCALGAALSTSVPVYTEHPGESAAALPLPDGL----------VRVPFRDAWPGTFS 119

  Fly   128 LIVEAWHDT--NNSGNARTNKLLIQRLLVQQVLEVSSEWKTNKSESQYTSLEYDFRVTCDLNYYG 190
            |::|.|.:.  .::|....|  |:.|::.::.|.....|..:...:....|.:.:|..|:....|
Mouse   120 LVIETWREQLGEHAGGPAWN--LLARVVGRRRLAAGGPWARDVQRTGTWELHFSYRARCEPPAVG 182

  Fly   191 SGCAKFCRPRDDSFGHSTCSETGEIICLTGWQGDYCHIPK-CAKGC--EHGHCDKPNQCVCQLGW 252
            :.||:.||.|.   ..|.|. .|...| |.:. |.|..|. |..||  |||:|::|::|.|..||
Mouse   183 AACARLCRSRS---APSRCG-PGLRPC-TPFP-DECEAPSVCRPGCSPEHGYCEEPDECRCLEGW 241

  Fly   253 KGALCNECVLEPNCIHGTCNKPWTCICNEGWGGLYCNQDLNYCTNHR---PCKNGGTCFNTGEGL 314
            .|.||...|...:|:                             |.|   |...|  |...|.| 
Mouse   242 TGPLCTVPVSTSSCL-----------------------------NSRVPGPASTG--CLLPGPG- 274

  Fly   315 YTCKCAPGYSGDDCENEIYSCDADVNPCQNGGTCIDEPHTKTGYKCHCANGWSGKMCEEKVLTCS 379
                               .||.  |||.|||:|.:   |...::|.|..|:.|..||...:||:
Mouse   275 -------------------PCDG--NPCANGGSCSE---TSGSFECACPRGFYGLRCEVSGVTCA 315

  Fly   380 DKPCHQGICRNVRPGLGSKGQ----GYQCECPIGYSGPNCDLQLDNCSPNPCINGGSCQPSG--- 437
            |.||..|       ||...|:    .|.|.||.|:.|.||:.::|.||..||.|||.|...|   
Mouse   316 DGPCFNG-------GLCVGGEDPDSAYVCHCPPGFQGSNCEKRVDRCSLQPCQNGGLCLDLGHAL 373

  Fly   438 KCICPAGFSGTRCETNIDDCLGHQCENGGTCIDMVNQYRCQCVPGFHGTHCSSKVDLCLIRPCAN 502
            :|.|.|||:|.|||.::|||.|..|.|||||::.....||.|..||.|..|..:.|.|..||||:
Mouse   374 RCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGSRRCSCALGFGGRDCRERADPCASRPCAH 438

  Fly   503 GGTCLNLNNDYQCTCRAGFTGKDC 526
            ||.|....:...|.|..|:.|..|
Mouse   439 GGRCYAHFSGLVCACAPGYMGVRC 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DlNP_001247193.1 MNNL 23..96 CDD:284966 21/81 (26%)
DSL 164..226 CDD:279722 16/61 (26%)
EGF_CA 291..329 CDD:238011 7/40 (18%)
EGF_CA 337..372 CDD:238011 12/34 (35%)
EGF_CA 453..488 CDD:238011 16/34 (47%)
EGF_CA 492..526 CDD:238011 13/33 (39%)
EGF_CA 529..564 CDD:238011
Dll3NP_031892.2 MNNL 25..85 CDD:284966 19/68 (28%)
DSL 156..246 CDD:302925 31/95 (33%)
EGF_CA 277..308 CDD:238011 13/35 (37%)
EGF_CA 314..349 CDD:238011 15/41 (37%)
EGF_CA 352..387 CDD:238011 17/34 (50%)
EGF_CA 389..424 CDD:238011 16/34 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 548..567
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.