DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dl and Dlk2

DIOPT Version :9

Sequence 1:NP_001247193.1 Gene:Dl / 42313 FlyBaseID:FBgn0000463 Length:833 Species:Drosophila melanogaster
Sequence 2:NP_001272942.1 Gene:Dlk2 / 106565 MGIID:2146838 Length:382 Species:Mus musculus


Alignment Length:464 Identity:121/464 - (26%)
Similarity:176/464 - (37%) Gaps:163/464 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 SGCAKFCRPRDDSFGHSTCSETGEIICLTGWQGDYCHIPKCAKGCE--HGHCDKPNQCVCQLGWK 253
            |||              .|.....::|:.|..........|:..|:  ||.|.....|.|..||:
Mouse     3 SGC--------------RCLNLVCLLCILGATSQPARADDCSSHCDLAHGCCAPDGSCRCDPGWE 53

  Fly   254 GALCNECVLEPNCIHGTCNKPWTCICNEGWGGLYCNQDLNYCTNHRPCKNGGTCFNTGEGLYTCK 318
            |..|..||..|.|.||||::||.|||:.||.|.:|::|.:.||:..||:|||.|...|.|.|.|.
Mouse    54 GLHCERCVRMPGCQHGTCHQPWQCICHSGWAGKFCDKDEHICTSQSPCQNGGQCVYDGGGEYHCV 118

  Fly   319 CAPGYSGDDCENEIYSCDADVNPCQNGGTCIDEPHTKTGYKCHCANGWSGKMCEEKVLTCSDKPC 383
            |.||:.|..||.:       ..||:..|.                                    
Mouse   119 CLPGFHGRGCERK-------AGPCEQAGF------------------------------------ 140

  Fly   384 HQGICRNVRPGLGSKGQGYQCECPIGYSGPNCDLQLDNCSPNPCINGGSCQPSGKCICPAGFSGT 448
                                                      ||.|||.||              
Mouse   141 ------------------------------------------PCRNGGQCQ-------------- 149

  Fly   449 RCETNIDDCLGHQCENGGTCIDMVNQYRCQCVPGFHGTHCSSKVDLCLIRPCANGGTCLNLNNDY 513
                          :|.|..::    :.|:|:.||.|.||...||.||:||||||.||::..|.:
Mouse   150 --------------DNQGFALN----FTCRCLAGFMGAHCEVNVDDCLMRPCANGATCIDGINRF 196

  Fly   514 QCTCRAGFTGKDCSVDIDECSSGPCHNGGTCMNRVNSFECVCANGFRGKQCD------------- 565
            .|.|..||.|:.|::::|:|:|.||..|..|.:||:.|:|:|.:|:.||.|:             
Mouse   197 SCLCPEGFAGRFCTINLDDCASRPCQRGARCRDRVHDFDCLCPSGYGGKTCELVLPAPEPASVGT 261

  Fly   566 -EESYDSVTFDA-----HQYGA---------TTQARADGLTNAQVVLIAVFSVAMPLVAVIAACV 615
             :....:|...|     |..||         ..:.:..||..:.:|.:.||...  ..|::.|.|
Mouse   262 PQMPTSAVVVPATGPAPHSAGAGLLRISVKEVVRRQESGLGESSLVALVVFGSL--TAALVLATV 324

  Fly   616 VFCMKRKRK 624
            :..::..|:
Mouse   325 LLTLRAWRR 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DlNP_001247193.1 MNNL 23..96 CDD:284966
DSL 164..226 CDD:279722 6/34 (18%)
EGF_CA 291..329 CDD:238011 17/37 (46%)
EGF_CA 337..372 CDD:238011 3/34 (9%)
EGF_CA 453..488 CDD:238011 7/34 (21%)
EGF_CA 492..526 CDD:238011 18/33 (55%)
EGF_CA 529..564 CDD:238011 15/34 (44%)
Dlk2NP_001272942.1 EGF_CA 89..129 CDD:238011 17/39 (44%)
EGF_CA 174..210 CDD:238011 18/35 (51%)
EGF_CA 212..248 CDD:238011 15/35 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24044
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.