DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dl and dlk2

DIOPT Version :9

Sequence 1:NP_001247193.1 Gene:Dl / 42313 FlyBaseID:FBgn0000463 Length:833 Species:Drosophila melanogaster
Sequence 2:XP_001921712.2 Gene:dlk2 / 100150992 ZFINID:ZDB-GENE-081107-4 Length:378 Species:Danio rerio


Alignment Length:444 Identity:130/444 - (29%)
Similarity:182/444 - (40%) Gaps:166/444 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 CE--HGHCDKPNQCVCQLGWKGALCNECVLEPNCIHGTCNKPWTCICNEGWGGLYCNQDLNYCTN 297
            ||  ||.|.:...|.|..||.|.:|::||..|.|:||||::||.|.|.:||.|.:|::|:..|:.
Zfish    42 CEIGHGKCAENGDCRCDPGWGGPMCDDCVRMPGCVHGTCHQPWQCSCMDGWAGRFCDKDVYVCSR 106

  Fly   298 HRPCKNGGTCFNTGEGLYTCKCAPGYSGDDCENEIYSCDADVNPCQNGGTCIDEPHTKTGYKCHC 362
            .:||.||.||..:..|.|:|.|..|:.|.|||.:...|....:||:|||.|.|            
Zfish   107 QQPCHNGATCELSDSGDYSCLCPEGFHGRDCELKAGPCQKTKSPCKNGGLCED------------ 159

  Fly   363 ANGWSGKMCEEKVLTCSDKPCHQGICRNVRPGLGSKGQGYQCECPIGYSGPNCDLQLDNCSPNPC 427
                                            ||            ||:                
Zfish   160 --------------------------------LG------------GYA---------------- 164

  Fly   428 INGGSCQPSGKCICPAGFSGTRCETNIDDCLGHQCENGGTCIDMVNQYRCQCVPGFHGTHCSSKV 492
                   |...|.|.|||:|.|||||:||                                    
Zfish   165 -------PELSCRCLAGFTGARCETNMDD------------------------------------ 186

  Fly   493 DLCLIRPCANGGTCLNLNNDYQCTCRAGFTGKDCSVDIDECSSGPCHNGGTCMNRVNSFECVCAN 557
              ||:||||||.|||:..|.:.|.|.|||||:.|::::|:|:|.||.|||.|::||::|:|||..
Zfish   187 --CLMRPCANGATCLDGVNRFSCLCPAGFTGRFCTINLDDCASQPCLNGGRCIDRVSNFQCVCPL 249

  Fly   558 GFRGKQCD------------------------------EESYDSVTFDAHQYGATTQARADGLTN 592
            ||.|:.|:                              ||....:||       .|.|..:||:.
Zfish   250 GFTGRTCELVSPTKSPLKAEHNPNMTLKPSHWTTPSGGEERLLKITF-------RTPAGGEGLSE 307

  Fly   593 AQ-VVLIAVFSVAMPLVAVIAACVV---------FCMKRKRKRAQEKDDAEARK 636
            .| :||:.:..:.:.:|.:.||.|:         .|..|...|.|.|...:..|
Zfish   308 FQLIVLLVLGGMTLAVVGLTAALVLRGYFQDRSASCQCRPAHRTQRKHSQQECK 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DlNP_001247193.1 MNNL 23..96 CDD:284966
DSL 164..226 CDD:279722
EGF_CA 291..329 CDD:238011 15/37 (41%)
EGF_CA 337..372 CDD:238011 7/34 (21%)
EGF_CA 453..488 CDD:238011 3/34 (9%)
EGF_CA 492..526 CDD:238011 19/33 (58%)
EGF_CA 529..564 CDD:238011 18/34 (53%)
dlk2XP_001921712.2 EGF_CA 104..138 CDD:238011 14/33 (42%)
EGF_CA 183..219 CDD:238011 22/73 (30%)
EGF_CA 221..257 CDD:238011 18/35 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I11894
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24044
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.