DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14280 and CG15153

DIOPT Version :9

Sequence 1:NP_001287405.1 Gene:CG14280 / 42312 FlyBaseID:FBgn0038695 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_609863.1 Gene:CG15153 / 35080 FlyBaseID:FBgn0032663 Length:364 Species:Drosophila melanogaster


Alignment Length:375 Identity:83/375 - (22%)
Similarity:132/375 - (35%) Gaps:138/375 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   268 CCVFVNGCGDVTSQQILYFESPNYPNAVREMMICVLIINVKKG-VQQLRLDFQMFELSRP----S 327
            |.|..|.......|:.:...||. ...:.|:..|...:....| |.|:|:||:..||.:|    :
  Fly    21 CQVACNARSGPVRQKRIVLSSPG-TGGLAELDTCQYRVAPWSGQVCQVRVDFERLELPQPQLNAN 84

  Fly   328 NG--DCVDDQFIVSGHNTNFQIPILCGINTGQHIYIHVGDSNEGKVYLSVFMKVSGGGR--SFNI 388
            :|  :|||  |:...|   |:   |||.|:|||:||.:   ..|:....:|...:..||  ::.:
  Fly    85 SGVLECVD--FLQIQH---FR---LCGRNSGQHLYIPI---RRGQELQLLFRLATSLGRQSTWQL 138

  Fly   389 KVTQVD----------------------------------------------------------- 394
            .:||::                                                           
  Fly   139 TLTQLECPRDSARGVGTRQPEVQTPTVRPILPFLGNFLPRTIFGGQSGIGSGSGPAAQLIQTFTS 203

  Fly   395 ------DNLAPNNCLQYFHDAEGVIKSFNYDTDGSIVDNREATYFNNLNYAICLARLKNVC--SV 451
                  :.|||..|.||:....|.|.|||:  .|.:       |..|:.|:||   :|...  .:
  Fly   204 PSSADLEMLAPLGCDQYYRTTTGGIVSFNF--AGGV-------YMPNMKYSIC---VKGAADNEI 256

  Fly   452 AY----------NTEQLGGDQPDFQIINKDEAENDL-ISDGQAGAGIFNCPDDFIA----INSVP 501
            :|          |:||.|   |.:....:......| :||      ..:.||.::.    :.:..
  Fly   257 SYKITHFELSKANSEQPG---PAYDTDCRSTVLTPLRVSD------YVSIPDAYMVGRPELQATH 312

  Fly   502 LCGERFNDGRESDDYTIHATVRDTAAGPIILPFRTDSEYVG--RGFRLLY 549
            .||... .|:|.           .|..|.:|.|.:||:..|  .||:|.|
  Fly   313 YCGNGL-AGQEL-----------VARPPFVLRFASDSQSSGSETGFQLTY 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14280NP_001287405.1 MPDZ_u10 132..>180 CDD:293272
CUB 275..391 CDD:238001 34/124 (27%)
CG15153NP_609863.1 CUB 217..352 CDD:294042 41/167 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR33236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.