DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unc79 and LOC101883855

DIOPT Version :9

Sequence 1:NP_650795.2 Gene:unc79 / 42310 FlyBaseID:FBgn0038693 Length:3028 Species:Drosophila melanogaster
Sequence 2:XP_009299247.2 Gene:LOC101883855 / 101883855 -ID:- Length:403 Species:Danio rerio


Alignment Length:411 Identity:148/411 - (36%)
Similarity:211/411 - (51%) Gaps:68/411 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 MGTRAAAFQAKLRALHEYHVRLLHNVLPAPSGVDIANNIKYFSQTLLTVLKD------------- 63
            |.|:|..|.:|:|.|.|||.|:|||:.|.|||.||||.:||||||||::|..             
Zfish     1 MSTKAEQFGSKIRYLQEYHNRVLHNIYPVPSGTDIANTLKYFSQTLLSILSRTGRKESQEASNLA 65

  Fly    64 -----------------------------VRTSPHELIRDPLED---------PTRMSAYPNLEY 90
                                         .|:..:.::||...|         ..::|.||:|:|
Zfish    66 VPMTMCLFPVPFPLTPSLRPQVSSINPTVTRSLLYSVLRDAPADRGGATQQSREVQLSEYPSLDY 130

  Fly    91 GNLYNALTMLIDVAPCIQYGQIVFGKALLQCLSCILPFLDKDLIDNLPYLVSSTISVLPPALHQC 155
            ..||..|..|:|:.|.:|:||...|:|:....:|:||||..|::..|||.:.||::..||.||:.
Zfish   131 QGLYATLVTLLDLVPLLQHGQHDLGQAIFYTTTCLLPFLSDDILSTLPYTMISTLATFPPFLHKD 195

  Fly   156 IINALCYYILPFTI---TRRSSDEQ---ECQACQSVSSVIMMVLQYSNNPAHHCQLLECLMTLKH 214
            ||..|....||..|   |||.....   ...||    |::|:.:||::||.:|||||||||..|.
Zfish   196 IIEYLSTSFLPMAILGSTRREGGVPAYVNLSAC----SMLMIAMQYTSNPVYHCQLLECLMKFKQ 256

  Fly   215 NVVKDILCVVAYGTAVSRTSAAKLLFYYWPAFN--ANLFDRKVLLSKLTNDLVPFTCQREHCPNS 277
            .|.||:|.|::||.:..:..|.::||:|||...  ..:.:.:.|.....|   |..||...|.||
Zfish   257 EVWKDLLYVISYGPSQVKPPAVQMLFHYWPNLKPPGAISEYRGLQYTAWN---PIHCQHIECQNS 318

  Fly   278 GNAEAAKVCYDHSISIAYAPDCPPPLYLCIECANEIHREHGSLEFGDILHPMQQVSMVCENKNCR 342
            .|..|.|:|.|.::|:|.. |.|||||:|.||:..|..:|... ..|:|.|..::|.:|:.|||.
Zfish   319 INKPAVKMCIDPTLSVALG-DKPPPLYICEECSQRIAGDHAEW-LVDVLLPQAEISAICQKKNCS 381

  Fly   343 SNEKSAFSICFSTECASFNGN 363
            |:.:.|...|||..|...:||
Zfish   382 SHVRRAVVTCFSAGCCGRHGN 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unc79NP_650795.2 UNC-79 78..600 CDD:291442 114/303 (38%)
LOC101883855XP_009299247.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D51194at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.