DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5250 and Atp1b4

DIOPT Version :9

Sequence 1:NP_650793.1 Gene:CG5250 / 42308 FlyBaseID:FBgn0038691 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_445833.2 Gene:Atp1b4 / 84396 RGDID:620994 Length:356 Species:Rattus norvegicus


Alignment Length:327 Identity:58/327 - (17%)
Similarity:107/327 - (32%) Gaps:123/327 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VAEYLYRRSIRTRNADPEMTV-------CRFIKLLLYFIGFFFVLGVFTTGLALVMIANHIYPDR 82
            |.|||:         |||..:       .|.:.|::||..:..:..|.|..:.::.:|  |.|..
  Rat    88 VNEYLW---------DPEKRMSLARTGQSRSLILVIYFFFYASLAAVITLFIYMLFLA--ISPYM 141

  Fly    83 PGCK---KFPGLATAPGHH-------------------------------VGDQKQIMWSPNNI- 112
            |...   |.||:...|..|                               :.::..|...|... 
  Rat   142 PTFTEQVKPPGVMIRPFAHSLNFNFNVSEPETWQRYVISLNGFLQGYNDSLQEEMNIDCPPGQYF 206

  Fly   113 ---------KDVANIQRAIMRTVKRYGLEGPKRLMGCNIDDSWGYMSGTPCILIKITQALGFQAV 168
                     |.....:|:.::...  |||.|          ::||.:|.||||:|:.:.:||:  
  Rat   207 IQDGDEDEDKKACQFKRSFLKNCS--GLEDP----------TFGYSTGQPCILLKMNRIVGFR-- 257

  Fly   169 TYDDALTLPEYAPDELFDYVVGLGSEERFNRIWVSCQVIEPRVDIQFDYHPVRFFDAEELFTSGN 233
                    ||:.........|..|.|.....|               :|:|              
  Rat   258 --------PEFGDPVKVSCKVQKGDENNIRSI---------------NYYP-------------- 285

  Fly   234 VFLNESSDDDGPTYKEDPRLRRI------ISVRLSNIPINEDIQIHCKAWAKNIPLHMVTVKMLV 292
                ||:..|...|....:|..:      :::..:::..|:::.:.|:...|.|...::..:.:.
  Rat   286 ----ESASFDLRYYPYYGKLTHVNYTSPLVAMHFTDVVKNQEVPVQCQLKGKGIVNDVINDRFVG 346

  Fly   293 RL 294
            |:
  Rat   347 RI 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5250NP_650793.1 Na_K-ATPase <143..281 CDD:298651 26/143 (18%)
Atp1b4NP_445833.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 32..77
Na_K-ATPase 90..348 CDD:395224 56/323 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166354507
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3927
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11523
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.