DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5250 and atp1b3b

DIOPT Version :9

Sequence 1:NP_650793.1 Gene:CG5250 / 42308 FlyBaseID:FBgn0038691 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_571745.1 Gene:atp1b3b / 64272 ZFINID:ZDB-GENE-001127-1 Length:275 Species:Danio rerio


Alignment Length:277 Identity:57/277 - (20%)
Similarity:99/277 - (35%) Gaps:96/277 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RVAEYLYRRSIRTRNADPEMTVCRFIKLLLYFIGFF-FVLGVFTTGLALVM--IANHI--YPDRP 83
            |..|::.|            |...:..:.|:::.|: |:.|:||..:.:::  :.:|.  |.||.
Zfish    23 RTGEFIGR------------TASSWALIFLFYLVFYGFLAGMFTLTMWVMLQTLDDHTPKYRDRV 75

  Fly    84 GCKKFPGLATAP---------------GHHVGDQKQIMWSPNNIKDVAN-------------IQR 120
            .   .|||...|               ..:|...:..:.|.|:....||             ::.
Zfish    76 A---NPGLMIRPRSLDIAFNRSIPQQYSKYVQHLEAFLQSYNDSLQEANEPCQEGMYFEQDDVEE 137

  Fly   121 AIMRTVKRYGLEGPKRLMGCN--IDDSWGYMSGTPCILIKITQALGFQ---------AVTYDDAL 174
            ..:...||      .:|..|:  .|.::||..|.|||::|:.:.:|.:         .|..|..|
Zfish   138 KKVCQFKR------SQLRQCSGLSDTTFGYSEGNPCIIVKMNRVIGLKPRGDPHIACTVKGDGTL 196

  Fly   175 TLPEYAPDE------LFDYVVGLGSEERFNRIWVSCQVIEPRVDIQF-----DY---HPVRFFDA 225
            .:..| |||      .|.|         :.:| :....::|.|.::.     ||   |.|     
Zfish   197 QMQLY-PDEGKIDKSFFPY---------YGKI-LHKNYVQPLVAVKLMLGENDYNIEHTV----- 245

  Fly   226 EELFTSGNVFLNESSDD 242
             |....|:..||....|
Zfish   246 -ECKVEGSDLLNNDERD 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5250NP_650793.1 Na_K-ATPase <143..281 CDD:298651 30/123 (24%)
atp1b3bNP_571745.1 Na_K-ATPase 10..268 CDD:278704 57/277 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596810
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3927
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11523
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.