DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5250 and atp1b2a

DIOPT Version :9

Sequence 1:NP_650793.1 Gene:CG5250 / 42308 FlyBaseID:FBgn0038691 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_021325519.1 Gene:atp1b2a / 64269 ZFINID:ZDB-GENE-001127-2 Length:293 Species:Danio rerio


Alignment Length:277 Identity:57/277 - (20%)
Similarity:96/277 - (34%) Gaps:99/277 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 LLLYFIGFFFVLGVFTTGLALVMIANHIY----PDRPGCKKFPGLATAPGHHVGDQKQIMWSPNN 111
            ||.|.:.:.|:.|||...:.::::....|    .||...   ||:...|   .|:..:|::|..|
Zfish    37 LLFYLVFYTFLAGVFCLTMYVMLLTLDDYQPTWQDRLAT---PGMMIRP---KGEALEIVYSREN 95

  Fly   112 --------------IKDVANIQRAIMR---TVKRYGLE--------GPKR--------LMGCN-- 141
                          :|...|.|:|:..   |..::.::        .|||        |..|:  
Zfish    96 TESWELYVQALDSFLKPYNNSQQAVNNDDCTPDQFNIQEDSGNVRNNPKRSCRFNRTTLEDCSGL 160

  Fly   142 IDDSWGYMSGTPCILIKITQALGFQ-------------AVTYDDALTLPEYAPDELFDYVVGLGS 193
            .|..:||..|.||||||:.:.:|.:             |..|.:.        ||..:....:|.
Zfish   161 TDRFYGYPDGKPCILIKLNRVIGMKPGKDGQSPYVTCGAKRYKEG--------DEWKEDAESIGE 217

  Fly   194 EERFNRIWVSCQVIEPRVDIQFDYHPVRFFDAEELFTSGNVFLNESSDDDGPTYKEDPRLRRIIS 258
            ...|          .|.......|:|.....|:         :|.|              :.:::
Zfish   218 IAYF----------PPNGTFNLMYYPYYGMKAQ---------VNYS--------------QPLVA 249

  Fly   259 VRLSNIPINEDIQIHCK 275
            |:..||..|.|:.:.||
Zfish   250 VKFMNISFNTDVNVECK 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5250NP_650793.1 Na_K-ATPase <143..281 CDD:298651 30/146 (21%)
atp1b2aXP_021325519.1 Na_K-ATPase 7..287 CDD:306737 57/277 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596811
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11523
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.