DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5250 and atp1b1a

DIOPT Version :9

Sequence 1:NP_650793.1 Gene:CG5250 / 42308 FlyBaseID:FBgn0038691 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_571743.3 Gene:atp1b1a / 64267 ZFINID:ZDB-GENE-001127-3 Length:306 Species:Danio rerio


Alignment Length:306 Identity:57/306 - (18%)
Similarity:114/306 - (37%) Gaps:100/306 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 NADPE----MTVCRFIKLLLYFIGFFFVL-GVF--TTGLALVMIANH--IYPDR--PGCKKFPGL 91
            |:|.:    .|.|.::|:.::::.|:..| |:|  |....|:.::|:  .|.||  |     |||
Zfish    17 NSDKKEFLGRTGCSWLKIFIFYVIFYGCLAGIFIGTIQAMLLTLSNYKPTYQDRVAP-----PGL 76

  Fly    92 ATAP-------GHHVGDQKQIMWSPNNI------------KDVANIQRAIMRT---VKRYGLEGP 134
            :.:|       .:::.|:...:...|:|            ||....:....:.   ..|..||..
Zfish    77 SHSPRPDKAEINYNINDESTYLPYVNHIDAFLKAYNEDVQKDDTKFEECGDKPQFYTDRGELESD 141

  Fly   135 KRL-MGCNIDDSW---------------GYMSGTPCILIKITQALGFQAVTYDDALTLPEYAPDE 183
            ..: ..|.....|               |:..|.||:::|:.:.:.|.........::||....:
Zfish   142 NGVRKACRFRREWLGECSGQKDEKLKNYGFDDGQPCLIVKLNRIVNFMPRPPASNDSIPEAVRPK 206

  Fly   184 LFDYVVGL----GSEERFNRIWVSCQVIEPRVDIQFDY------HPVRFFDAEELFTSGNVFLNE 238
            |...|:.:    ..||..|.:.            |..|      .|::::               
Zfish   207 LQGNVIPIHCSSKREEEANLLG------------QIKYFGLGTGFPLQYY--------------- 244

  Fly   239 SSDDDGPTYKE--DPR-LRRIISVRLSNIPINEDIQIHCKAWAKNI 281
                  |.|.:  .|: |:.:::::..||..:.|:::.||.:.:||
Zfish   245 ------PYYGKLLQPQYLQPLVAIKFYNITTDVDVRVECKVYGENI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5250NP_650793.1 Na_K-ATPase <143..281 CDD:298651 26/165 (16%)
atp1b1aNP_571743.3 Na_K-ATPase 8..303 CDD:298651 57/306 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596814
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3927
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11523
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.890

Return to query results.
Submit another query.