DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5250 and ATP4B

DIOPT Version :9

Sequence 1:NP_650793.1 Gene:CG5250 / 42308 FlyBaseID:FBgn0038691 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_000696.1 Gene:ATP4B / 496 HGNCID:820 Length:291 Species:Homo sapiens


Alignment Length:286 Identity:63/286 - (22%)
Similarity:108/286 - (37%) Gaps:96/286 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 TVCRFIKLLLYFIGFFFVL-GVFTTGLALVMIANHIY-PDRPGCKKFPGLATAPG---------- 96
            |:.|::.:.||::.|:.|: |:|...|.::|.....| ||.....:.||:...|.          
Human    33 TLSRWVWISLYYVAFYVVMTGLFALCLYVLMQTVDPYTPDYQDQLRSPGVTLRPDVYGEKGLEIV 97

  Fly    97 HHVGDQK------QIM------WSPNNIKDVANIQRAIMRTVKRYGLEGPKR------------- 136
            ::|.|.:      |.:      :||...:|..|.      |.::|..:...|             
Human    98 YNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINC------TSEQYFFQESFRAPNHTKFSCKFTA 156

  Fly   137 --LMGCN--IDDSWGYMSGTPCILIKITQALGFQAVTYDDALTLPEYAPDELFDYVVGLGSEERF 197
              |..|:  .|.::|:..|.||.:||:.:.:.|          ||..            ||..| 
Human   157 DMLQNCSGLADPNFGFEEGKPCFIIKMNRIVKF----------LPSN------------GSAPR- 198

  Fly   198 NRIWVSCQVI-EPR---VDIQFDYHPVRFFDAEELFTSGNVFLNESSDDDGPTY--KEDPRLRR- 255
                |.|..: :||   ..:|..|:|          .:|...|:..     |.|  |..|.... 
Human   199 ----VDCAFLDQPRELGQPLQVKYYP----------PNGTFSLHYF-----PYYGKKAQPHYSNP 244

  Fly   256 IISVRLSNIPINEDIQIHCKAWAKNI 281
            :::.:|.|||.|.::.|.||..|:::
Human   245 LVAAKLLNIPRNAEVAIVCKVMAEHV 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5250NP_650793.1 Na_K-ATPase <143..281 CDD:298651 35/144 (24%)
ATP4BNP_000696.1 Na_K_ATPase_bet 2..291 CDD:273446 63/286 (22%)
immunoglobulin-like 194..291 25/97 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160442
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3927
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11523
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.