DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5250 and ATP1B1

DIOPT Version :9

Sequence 1:NP_650793.1 Gene:CG5250 / 42308 FlyBaseID:FBgn0038691 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001668.1 Gene:ATP1B1 / 481 HGNCID:804 Length:303 Species:Homo sapiens


Alignment Length:304 Identity:69/304 - (22%)
Similarity:114/304 - (37%) Gaps:122/304 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 FIKLLLYFIGFFFVL-GVF--TTGLALVMIANH--IYPDR---PGCKKFPGLATAPGHHVGDQKQ 104
            :.|:||:::.|:..| |:|  |..:.|:.|:..  .|.||   ||..:.|.:         .:.:
Human    32 WFKILLFYVIFYGCLAGIFIGTIQVMLLTISEFKPTYQDRVAPPGLTQIPQI---------QKTE 87

  Fly   105 IMWSPNNIKD----VANIQRAI-----------------------------------MRTVKRYG 130
            |.:.||:.|.    |.||.|.:                                   .|.|.|:.
Human    88 ISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFNHERGERKVCRFK 152

  Fly   131 LEGPKRLMGCNIDDSWGYMSGTPCILIKITQALGFQ--------AVTYDDALTLPEYAP------ 181
            ||......|.| |:::||..|.|||:||:.:.|||:        ..||......|...|      
Human   153 LEWLGNCSGLN-DETYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPVMKYNPNVLPVQCTGK 216

  Fly   182 -DELFDYV-----VGLGSEERFNRIWVSCQVIEPRVDIQFDYHPVRFFDAEELFTSGNVFLNESS 240
             ||..|.|     .|||:...|                     |::::                 
Human   217 RDEDKDKVGNVEYFGLGNSPGF---------------------PLQYY----------------- 243

  Fly   241 DDDGPTYKE--DPR-LRRIISVRLSNIPINEDIQIHCKAWAKNI 281
                |.|.:  .|: |:.:::|:.:|:.::.:|:|.|||:.:||
Human   244 ----PYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENI 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5250NP_650793.1 Na_K-ATPase <143..281 CDD:298651 36/160 (23%)
ATP1B1NP_001668.1 Na_K_ATPase_bet 1..303 CDD:273446 69/304 (23%)
immunoglobulin-like 191..303 26/135 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160439
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11523
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.