DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5250 and atp4b

DIOPT Version :9

Sequence 1:NP_650793.1 Gene:CG5250 / 42308 FlyBaseID:FBgn0038691 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001005806.1 Gene:atp4b / 448282 XenbaseID:XB-GENE-944891 Length:295 Species:Xenopus tropicalis


Alignment Length:266 Identity:49/266 - (18%)
Similarity:97/266 - (36%) Gaps:72/266 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 TVCRFIKLLLYFIGFFFV-LGVFTTGL-ALVMIANHIYPDRPGCKKFPGLATAPGHHVGDQKQIM 106
            |..:::.:.||:..|:.: :|:|...: :|:...|...||.....|.||:...|..:..:..::.
 Frog    33 TFAKWVYISLYYAAFYVIMIGIFALSIYSLMKTMNPFVPDYQDELKSPGVTMRPDPYGDEVIELF 97

  Fly   107 WSPNN-------IKDVANIQRAIMRTVK-----------RYGLEGPKR-----------LMGCN- 141
            ::...       :..:.:......:||:           |.....||.           |..|: 
 Frog    98 YNKAENSTYLPLVTSLCDFLSVYNKTVQEKMNANCSDNTRMSCANPKENSKSCQFTTDMLGNCSW 162

  Fly   142 -IDDSWGYMSGTPCILIKITQALGFQAVTYDDALTLPEYAPDELFDYVVGLGSEERFNRIWVSCQ 205
             .|.::||.|||||:.||:.:.:.|    .....|:|          :|...:|..         
 Frog   163 EHDHTFGYKSGTPCLFIKMNRIINF----VPGNKTVP----------LVNCSAEHG--------- 204

  Fly   206 VIEPRVDIQFDYHPVRFFDAEELF-TSGNVFLNESSDDDGPTYKEDPRLRRIISVRLSNIPINED 269
                      |...|.::...:.: |.|..:.........|.|...     :::|:|.|.|:|::
 Frog   205 ----------DLGDVHYYPGNDTYGTIGFQYFPYCGKKMQPNYTNP-----LVAVKLLNPPLNKE 254

  Fly   270 IQIHCK 275
            :.:.||
 Frog   255 LSVVCK 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5250NP_650793.1 Na_K-ATPase <143..281 CDD:298651 28/134 (21%)
atp4bNP_001005806.1 Na_K-ATPase 15..280 CDD:366001 49/266 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11523
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.