DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5250 and atp1b3

DIOPT Version :9

Sequence 1:NP_650793.1 Gene:CG5250 / 42308 FlyBaseID:FBgn0038691 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_989087.1 Gene:atp1b3 / 394687 XenbaseID:XB-GENE-485127 Length:279 Species:Xenopus tropicalis


Alignment Length:300 Identity:54/300 - (18%)
Similarity:101/300 - (33%) Gaps:116/300 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 LLLYFIGFFFVLGVFTTGLALVM--IANHI--YPDR---PGCKKFPGLA---------------- 92
            ||.|.:.:.|:.|:||..:.:::  :.:.:  |.||   ||....|..|                
 Frog    40 LLFYLVFYGFLAGLFTLTMWVMLQTLDDSVPKYRDRVSSPGLMISPKSAGLEIKFTRNKTQSYQE 104

  Fly    93 ----------------------TAPGHHVGDQKQIMWSPNNIKDVANIQRAIMRTVKRYGLEGPK 135
                                  .|||.:. ||.:     .:.|......|:.:....  |:|   
 Frog   105 YIQTLHTFLTPYNDAIQAKNDLCAPGLYF-DQDE-----KDEKKACQFNRSSLGLCS--GIE--- 158

  Fly   136 RLMGCNIDDSWGYMSGTPCILIKITQALGFQAVTYDDALTLPEYAPDELFDYVVGLGSEERFNRI 200
                   |:::||..|.||:::|:.:.:|.:          ||..|.                  
 Frog   159 -------DNTFGYNEGKPCVIVKMNRIIGLK----------PEGNPK------------------ 188

  Fly   201 WVSCQVIEPRVDIQFDYHPVRFFDAEELFTSGNVFLNESSDDDGPTYKEDPR---LRRIISVRLS 262
             ::|  .....|:...|.|          .:|.:.|...     |.|.:...   ::.:::|::.
 Frog   189 -INC--TSKTEDVNLQYFP----------ENGKIDLMYF-----PYYGKKTHVNYVQPLVAVKII 235

  Fly   263 NIPIN---EDIQIHCKA-WAKNIPLHMVTVKMLVRLTAPV 298
            ..|.|   ::|.:.||. .::|:.......|.|.|:|..|
 Frog   236 PPPYNSSLDEISLECKIHGSRNLKNEDERDKFLGRVTFKV 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5250NP_650793.1 Na_K-ATPase <143..281 CDD:298651 25/144 (17%)
atp1b3NP_989087.1 Na_K-ATPase 14..272 CDD:366001 52/295 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11523
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.