DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5250 and atp1b2

DIOPT Version :9

Sequence 1:NP_650793.1 Gene:CG5250 / 42308 FlyBaseID:FBgn0038691 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_989070.1 Gene:atp1b2 / 394667 XenbaseID:XB-GENE-1007085 Length:306 Species:Xenopus tropicalis


Alignment Length:303 Identity:60/303 - (19%)
Similarity:113/303 - (37%) Gaps:99/303 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 IGFFFVLGVFTTG---LALVMIANHIYPDRPGCKKFPGLATAPGHHV---GDQKQIM-------- 106
            :.|:.|...|.||   |::.::...|....|   |:....|:||..:   .|..:|:        
 Frog    41 VSFYLVFYAFLTGMFALSMYVMLQTIDEYTP---KYWDRLTSPGLMIRPKTDTLEIVYSISGNSS 102

  Fly   107 WSP-----NNI----KDVANIQRAIM------------RTVKRYGLEGPKR--------LMGCN- 141
            |:|     |::    .|...:|:..:            ..|:.|    ||:        |..|: 
 Frog   103 WAPYVSQLNSMLDPYNDTVQMQQGSVCPSGVFNKQDDTGDVRNY----PKKACQFLRSSLGDCSG 163

  Fly   142 -IDDSWGYMSGTPCILIKITQALGFQAVTYDDALTLPEYAPDELFDYVVGLGSEERFNRIWVSCQ 205
             .|.::||.:|:||:|||:.:.:.|          .|...|        .|.:    ..|.::|.
 Frog   164 LTDPTYGYSTGSPCLLIKMNKIINF----------YPGVIP--------SLSN----TSITINCT 206

  Fly   206 VIEPRVDIQFDYHPVRFFDAEELFTSGNVFLNESSDDDG---------PTYKEDPRLRR-----I 256
            .....:|        :...:...:.|.|. .|.:|:...         |.|..  |.::     :
 Frog   207 GTTANMD--------QMLGSRTYYPSSNP-SNGTSNGTSLGTMDLMYFPYYGN--RAQKNYSQPL 260

  Fly   257 ISVRLSNIPINEDIQIHCKAWAKNIPLHMVTVKMLVRLTAPVH 299
            ::|:..|:.:|:|:.:.|:|.|.||..:....|...|::..:|
 Frog   261 VAVKFYNLTLNQDLYVQCRANAVNINTNDSQDKFSGRVSFKLH 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5250NP_650793.1 Na_K-ATPase <143..281 CDD:298651 30/151 (20%)
atp1b2NP_989070.1 Na_K-ATPase 15..299 CDD:366001 59/297 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.