DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5250 and nrv3

DIOPT Version :9

Sequence 1:NP_650793.1 Gene:CG5250 / 42308 FlyBaseID:FBgn0038691 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001260675.1 Gene:nrv3 / 35408 FlyBaseID:FBgn0032946 Length:313 Species:Drosophila melanogaster


Alignment Length:327 Identity:70/327 - (21%)
Similarity:129/327 - (39%) Gaps:94/327 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YSGPYELGRLRRRRDMRVAEYLYRRSIRTRNADPEMTVCR----FIKLLLYFIGFFFVLGVFTTG 68
            |:.|.::|:....:     ::|:       |::....:.|    :.|:||::|.|:..|..|...
  Fly    10 YAPPVKMGKWEGFK-----KFLW-------NSETSQCLGRTGSSWAKILLFYIIFYAALTGFFAA 62

  Fly    69 LALV------------MIANHIYPDRPGCKKFPGLATAPGHHVGDQKQIMWSPNNIKDVANIQRA 121
            :..|            |:.|.:....||.    |....| .....:..::|..::.||  |.:..
  Fly    63 IFTVFYQTLDNEKPKWMLDNGLIGSNPGL----GFRPMP-PEANVESTLVWYESSKKD--NYKYW 120

  Fly   122 IMRTVK--RY--------------GLEGP---KRLMG--------CNIDDSWGYMSGTPCILIKI 159
            :..|.:  :|              ..|.|   .::.|        |..|:::||....|||.:|:
  Fly   121 VDETSRFLKYHTYQDLEKQNQVNCSFEHPPQDDKVCGIDFSSFSPCTADNNFGYHVARPCIFLKL 185

  Fly   160 TQALGFQAVTYDDALTLPEYAPDELFDYVVGLGS--EERFNRIWVSCQVIEPRVDIQ----FDYH 218
            .:...:....|:|:.|||::.|:||..::....|  ....|.:||||:...| .|::    .||:
  Fly   186 NKIYNWIPEIYNDSKTLPDHMPEELKQHIKEKQSLRPNETNVVWVSCEGENP-ADVENIKARDYY 249

  Fly   219 P----VRFFDAEELFTSGNVFLNESSDDDGPTYKEDPRLRRIISVRLSNIPINEDIQIHCKAWAK 279
            |    .|::     |...|:               ...:..|::|:.: :.....|.|.|||||:
  Fly   250 PRMGFPRYY-----FPFKNI---------------QGYIPPIVAVQFT-VETGVLINIECKAWAR 293

  Fly   280 NI 281
            ||
  Fly   294 NI 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5250NP_650793.1 Na_K-ATPase <143..281 CDD:298651 38/147 (26%)
nrv3NP_001260675.1 Na_K-ATPase 20..307 CDD:395224 67/317 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473150
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3927
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11523
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.