DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5250 and nrv2

DIOPT Version :9

Sequence 1:NP_650793.1 Gene:CG5250 / 42308 FlyBaseID:FBgn0038691 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001014475.1 Gene:nrv2 / 33953 FlyBaseID:FBgn0015777 Length:323 Species:Drosophila melanogaster


Alignment Length:279 Identity:62/279 - (22%)
Similarity:102/279 - (36%) Gaps:70/279 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 KLLLYFIGFFFVLGVFTTGLALVMIANHIY--------P----DRPGCKKFPGLATAPGHHVGD- 101
            |:.::::.|:.||.      |||.|....:        |    ||......|||...|...|.: 
  Fly    50 KIGIFYVAFYGVLA------ALVAICMWAFFQTLDPRIPKWTLDRSLIGTNPGLGFRPLPPVDNV 108

  Fly   102 QKQIMW----SPNNIKDVANIQRAIMRTVKRYGL--------------EGPKRLMGCNID----- 143
            :..::|    ...|.|...:.....:...|..||              :.|.:...|::|     
  Fly   109 ESTLIWYKGTQHENYKHWTDSLDDFLAVYKVPGLTPGRGQNIYNCDYNQPPPKGQVCDVDIKTWS 173

  Fly   144 -----DSWGYMSGTPCILIKITQALGFQAVTYDDALTLPEYAPDELFDYV--VGLGSEERFNRIW 201
                 :::.|....|||.:|:.:..|:....|:.:..||...|..|..|:  |.....|:.|.||
  Fly   174 PCTKENNYSYHKSAPCIFLKLNKIYGWIPEYYNRSNDLPANMPASLKTYIAEVEKTQPEKLNTIW 238

  Fly   202 VSCQVIEPRVDIQ----FDYHPVRFFDAEELFTSGNVFLNESSDDDGPTYKEDPRLRRIISVRLS 262
            |||:...| .|.:    .:|.|:|.|       .|..:         |....:..|..:::|...
  Fly   239 VSCEGENP-ADQENIGAVNYLPIRGF-------PGYFY---------PYQNSEGYLSPLVAVHFQ 286

  Fly   263 NIPINEDIQIHCKAWAKNI 281
            .......|.:.|:|||:||
  Fly   287 RPKRGIIINVECRAWARNI 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5250NP_650793.1 Na_K-ATPase <143..281 CDD:298651 36/153 (24%)
nrv2NP_001014475.1 Na_K-ATPase 24..317 CDD:278704 62/279 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473149
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3927
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11523
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.