DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5250 and CG33310

DIOPT Version :9

Sequence 1:NP_650793.1 Gene:CG5250 / 42308 FlyBaseID:FBgn0038691 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_995718.2 Gene:CG33310 / 2768910 FlyBaseID:FBgn0053310 Length:876 Species:Drosophila melanogaster


Alignment Length:307 Identity:70/307 - (22%)
Similarity:128/307 - (41%) Gaps:55/307 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SGPYELGRLRRRRD-MRVAEYLY------RR--------SIRTRNADPEMTVCRFIKLLLYFIGF 58
            :|||::.....||. .:..||.:      ||        ..:.|.....:....|..|.:.|:..
  Fly   556 NGPYKMPTKEDRRTYYKGCEYHFPGRTEWRRLFFNKIHGKYKLRRPSHWLYTLVFSVLYILFVII 620

  Fly    59 F------FVLGVFTTGLALVMIANHIYPDRPGCKKFPGLATAPGHHVGDQKQIMWSPNNIKDVAN 117
            |      |:....:..:.::.:|.            |.::..|.....:.|.:.:.|.|..:|..
  Fly   621 FSMAWFDFIKDDASRKVPMIKMAQ------------PFISFTPIGPRTNPKAVSFDPRNSTEVME 673

  Fly   118 IQRAIMRTVKRYGLEGPKRLMG-CNIDDSWGYMSGTPCILIKITQALGFQAVTYDDALTLPEYAP 181
            ....||..:::||..|.....| |..::.:||.||.||:.:|:.:.:||:...|.::..|.:...
  Fly   674 KYAGIMALLEKYGDYGHNPRFGTCTANEKFGYPSGEPCVFLKVNRIIGFKTEPYINSDELVKAKI 738

  Fly   182 DEL-FDYVVGL-----GSEERFNRIWVSCQVIEPRVDIQFDYHP-----VRFFDAEELFTSGNVF 235
            ||: |..:..|     ..|...||.|::|:..:.: ::..::||     ..:.|.||..   ...
  Fly   739 DEVEFTALKRLLENTTTEEGHLNRTWITCRSDKDK-NVLIEFHPEPAIRTEYTDIEEKI---EYI 799

  Fly   236 LNESSDD-DGPTYKEDPRLRRIISVRLSNIPINEDIQIHCKAWAKNI 281
            .||.... .||.     .:.||:::::.|:..||.:.|:||.||:||
  Fly   800 ANEGKKSFFGPN-----DVNRIVALKIKNLKANERVHINCKMWAQNI 841

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5250NP_650793.1 Na_K-ATPase <143..281 CDD:298651 39/149 (26%)
CG33310NP_995718.2 Na_K-ATPase <703..847 CDD:298651 41/148 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473146
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11523
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.