DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5250 and Atp1b3

DIOPT Version :9

Sequence 1:NP_650793.1 Gene:CG5250 / 42308 FlyBaseID:FBgn0038691 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_037045.1 Gene:Atp1b3 / 25390 RGDID:2172 Length:279 Species:Rattus norvegicus


Alignment Length:225 Identity:51/225 - (22%)
Similarity:76/225 - (33%) Gaps:81/225 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 LLLY--FIGFFFVLGVFTTGLALVMIANHI--YPDR---PGCKKFPGLATAPGHHVGDQKQIMWS 108
            ||.|  |.||...|..||..:.|..:.:.:  |.|:   ||...||...||.     |....|..
  Rat    40 LLFYLVFYGFLAALFTFTMWVMLQTLNDEVPKYRDQIPSPGLMVFPKPPTAL-----DYTYSMSD 99

  Fly   109 PNN----IKDVANIQRAIMRTVKRYGLEGPKRLMGC---------------------------NI 142
            |:.    ::|:.|.       :|.|.:|..|.|..|                           .:
  Rat   100 PHTYKKFVEDLKNF-------LKPYSVEEQKNLTDCPGGALFHQEGPDYSACQFPVSLLQECSGV 157

  Fly   143 DDS-WGYMSGTPCILIKITQALGF------------------QAVTY-DDALTLPEYAP------ 181
            :|| :||..|.||:|:|:.:.:..                  ..||| ||.|...:|.|      
  Rat   158 NDSNFGYSKGQPCVLVKMNRIIELVPDGAPYITCITKEENIANIVTYPDDGLIDLKYFPYYGKKR 222

  Fly   182 -----DELFDYVVGLGSEERFNRIWVSCQV 206
                 ..|....|..|::.....:.:.||:
  Rat   223 HVGYRQPLVAVQVIFGADATKKEVTIECQI 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5250NP_650793.1 Na_K-ATPase <143..281 CDD:298651 22/95 (23%)
Atp1b3NP_037045.1 Na_K_ATPase_bet 1..279 CDD:273446 51/225 (23%)
immunoglobulin-like. /evidence=ECO:0000250 186..279 13/67 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166354503
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3927
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11523
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.