DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5250 and Shbg

DIOPT Version :9

Sequence 1:NP_650793.1 Gene:CG5250 / 42308 FlyBaseID:FBgn0038691 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_006246648.1 Gene:Shbg / 24775 RGDID:3671 Length:445 Species:Rattus norvegicus


Alignment Length:159 Identity:37/159 - (23%)
Similarity:60/159 - (37%) Gaps:47/159 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 LATAPGHHVGDQKQIMWSPNNIKDVANIQRAIMRTVKRYGLEGP--KRLMGCNIDDSWGYMSGTP 153
            |.|.|..|.|         ..::.:..||.| ..:..:|...||  :.:....||          
  Rat    61 LLTLPPTHQG---------RTLRHIDPIQSA-QDSPAKYLSNGPGQEPVTVLTID---------- 105

  Fly   154 CILIKITQ-ALGFQAVTYDDALTLPE----YAPDELFD--YVVGLGS---EERFNRIWVSCQV-I 207
              |.||:: :..|:..|:|     ||    |......|  :::||..   |.:.:.:|....| .
  Rat   106 --LTKISKPSSSFEFRTWD-----PEGVIFYGDTNTEDDWFMLGLRDGQLEIQLHNLWARLTVGF 163

  Fly   208 EPRVDIQFDYHPVRFFDAEELFTSGNVFL 236
            .||:: ...:|||      ||..:|:..|
  Rat   164 GPRLN-DGRWHPV------ELKMNGDSLL 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5250NP_650793.1 Na_K-ATPase <143..281 CDD:298651 25/105 (24%)
ShbgXP_006246648.1 Laminin_G_1 118..248 CDD:278483 20/80 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3927
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.