DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5250 and Atp1b2

DIOPT Version :9

Sequence 1:NP_650793.1 Gene:CG5250 / 42308 FlyBaseID:FBgn0038691 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_036639.2 Gene:Atp1b2 / 24214 RGDID:2171 Length:290 Species:Rattus norvegicus


Alignment Length:282 Identity:58/282 - (20%)
Similarity:102/282 - (36%) Gaps:105/282 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 LLLYFIGFFFVLGVFTTGLALVM--IANHI--YPDRPGCKKFPGLATAPGHHVGDQKQIMWSPNN 111
            ||.|.:.:.|:..:||..:.:::  :::|.  |.||        ||| ||..:..:.:.:....|
  Rat    41 LLFYLVFYGFLTAMFTLTMWVMLQTVSDHTPKYQDR--------LAT-PGLMIRPKTENLDVIVN 96

  Fly   112 IKDVANIQRAIMRTVK--------------------RY-------GLEGPKR--------LMGCN 141
            |.|..:..:.:.:..|                    ||       .|..|||        |..|:
  Rat    97 ISDTESWDQHVQKLNKFLEPYNDSIQAQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGNCS 161

  Fly   142 -IDD--SWGYMSGTPCILIKITQALGFQAVTYDDALTLPEYAPDELFDYVVGLGSEERFNRIWVS 203
             |.|  .:||.:|.||:.||:.:.:.|.|                        |:.:..|   |:
  Rat   162 GIGDPTHYGYSTGQPCVFIKMNRVINFYA------------------------GANQSMN---VT 199

  Fly   204 CQVIEPRVDIQFDYHPVRFFDAEELF------TSGNVFLNESSDDDGPTYKEDPRL---RRIISV 259
            |...:..             |||.|.      .:||:.|...     |.|.:...:   :.:::|
  Rat   200 CVGKKDE-------------DAENLGHFIMFPANGNIDLMYF-----PYYGKKFHVNYTQPLVAV 246

  Fly   260 RLSNIPINEDIQIHCKAWAKNI 281
            :..|:..|.::.:.|:..|.||
  Rat   247 KFLNVTPNVEVNVECRINAANI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5250NP_650793.1 Na_K-ATPase <143..281 CDD:298651 28/148 (19%)
Atp1b2NP_036639.2 Na_K_ATPase_bet 2..289 CDD:273446 58/282 (21%)
immunoglobulin-like. /evidence=ECO:0000250 193..290 19/97 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166354506
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3927
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11523
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.