DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5250 and ATP1B4

DIOPT Version :9

Sequence 1:NP_650793.1 Gene:CG5250 / 42308 FlyBaseID:FBgn0038691 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001135919.1 Gene:ATP1B4 / 23439 HGNCID:808 Length:357 Species:Homo sapiens


Alignment Length:314 Identity:58/314 - (18%)
Similarity:105/314 - (33%) Gaps:123/314 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VAEYLYRRSIRTRNADPE--MTVCR-----FIKLLLYFIGFFFVLGVFTTGL-ALVMIANHIYPD 81
            ::|||:         |||  |.:.|     .:.||:||..:..:..|.|..: .|.:..:...|.
Human    89 MSEYLW---------DPERRMFLARTGQSWSLILLIYFFFYASLAAVITLCMYTLFLTISPYIPT 144

  Fly    82 RPGCKKFPGLATAPGHH-------------------------------VGDQKQIMWSPNNI--- 112
            .....|.||:...|..|                               :.::..:...|...   
Human   145 FTERVKPPGVMIRPFAHSLNFNFNVSEPDTWQHYVISLNGFLQGYNDSLQEEMNVDCPPGQYFIQ 209

  Fly   113 -------KDVANIQRAIMRTVKRYGLEGPKRLMGCNIDDSWGYMSGTPCILIKITQALGFQAVTY 170
                   |.....:|:.::...  |||.|          ::||.:|.||||:|:.:.:||:    
Human   210 DGNEDEDKKACQFKRSFLKNCS--GLEDP----------TFGYSTGQPCILLKMNRIVGFR---- 258

  Fly   171 DDALTLPEYAPDELFDYVVGLGSEERFNRIWVSCQVIE-PRVDIQ-FDYHPVRFFDAEELFTSGN 233
                  ||            ||     :.:.|||:|.. ...||: ..|:|              
Human   259 ------PE------------LG-----DPVKVSCKVQRGDENDIRSISYYP-------------- 286

  Fly   234 VFLNESSDDDGPTYKEDPRLRRI------ISVRLSNIPINEDIQIHCKAWAKNI 281
                ||:..|...|....:|..:      :::..:::..|:.:.:.|:...|.:
Human   287 ----ESASFDLRYYPYYGKLTHVNYTSPLVAMHFTDVVKNQAVPVQCQLKGKGV 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5250NP_650793.1 Na_K-ATPase <143..281 CDD:298651 30/145 (21%)
ATP1B4NP_001135919.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 15..80
Na_K-ATPase 82..351 CDD:306737 58/314 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160440
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3927
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11523
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.