powered by:
Protein Alignment CG5250 and Shbg
DIOPT Version :9
Sequence 1: | NP_650793.1 |
Gene: | CG5250 / 42308 |
FlyBaseID: | FBgn0038691 |
Length: | 311 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_035497.1 |
Gene: | Shbg / 20415 |
MGIID: | 98295 |
Length: | 403 |
Species: | Mus musculus |
Alignment Length: | 75 |
Identity: | 18/75 - (24%) |
Similarity: | 31/75 - (41%) |
Gaps: | 24/75 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 205 QVIEPRVDIQFDYHPVRFFDAEELFTSGNVFLNESSDDDGPTYKEDPRLRRIISVRLSNIPINED 269
::.:|....:| |.:|.| |.:|. |.|..||... ::.:|...: :
Mouse 66 KISKPHSSFEF-----RTWDPE-----GVIFY-------GDTNTEDDWF--LLGLRAGQL----E 107
Fly 270 IQIHCKAWAK 279
||:| .|||:
Mouse 108 IQLH-NAWAR 116
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3927 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.