DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5250 and Shbg

DIOPT Version :9

Sequence 1:NP_650793.1 Gene:CG5250 / 42308 FlyBaseID:FBgn0038691 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_035497.1 Gene:Shbg / 20415 MGIID:98295 Length:403 Species:Mus musculus


Alignment Length:75 Identity:18/75 - (24%)
Similarity:31/75 - (41%) Gaps:24/75 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 QVIEPRVDIQFDYHPVRFFDAEELFTSGNVFLNESSDDDGPTYKEDPRLRRIISVRLSNIPINED 269
            ::.:|....:|     |.:|.|     |.:|.       |.|..||...  ::.:|...:    :
Mouse    66 KISKPHSSFEF-----RTWDPE-----GVIFY-------GDTNTEDDWF--LLGLRAGQL----E 107

  Fly   270 IQIHCKAWAK 279
            ||:| .|||:
Mouse   108 IQLH-NAWAR 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5250NP_650793.1 Na_K-ATPase <143..281 CDD:298651 18/75 (24%)
ShbgNP_035497.1 Laminin_G_1 76..206 CDD:333802 17/65 (26%)
LamG 225..369 CDD:389952
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3927
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.