DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5250 and nkb-1

DIOPT Version :9

Sequence 1:NP_650793.1 Gene:CG5250 / 42308 FlyBaseID:FBgn0038691 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_492506.1 Gene:nkb-1 / 182726 WormBaseID:WBGene00007646 Length:320 Species:Caenorhabditis elegans


Alignment Length:352 Identity:76/352 - (21%)
Similarity:128/352 - (36%) Gaps:113/352 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DAIIYSGPYELGRLRRRRDMRVAEYLYRRSIRTRNADPEMTVCRFIKLLLYFIGFFFVLGVF-TT 67
            :|.:.:|....|..|........|:||.:...|...   .|...:.::::::|.|:..|..| .|
 Worm     8 NATLMNGVETTGPARDDVPETFREFLYNKKNGTVMG---RTGKSWFQIIVFYIIFYAFLAAFWLT 69

  Fly    68 GLALVMIANHIYPDRPGCKKFPGLATA----PGHHVGDQKQIMWSPN------NIKDVANIQRAI 122
            .|.:.|  ..:.|..|   :|.|..|.    ||  ||.|..:...|:      |::|..: .:|.
 Worm    70 CLTIFM--KTLDPKVP---RFYGKGTIIGVNPG--VGYQPWLKERPDSTLIKYNLRDQKS-YKAY 126

  Fly   123 MRTVKRY---------------------GLE-GPKRL----------MGCNIDDSWGYMSGTPCI 155
            :..:|.|                     .|| .|..|          .||:....:||.||.||:
 Worm   127 LEQMKTYLTKYDSNATETRECGAGDSNDDLEKNPDALPCRFDLSVFDKGCSEKSDFGYKSGKPCV 191

  Fly   156 LIKITQALGFQAVTYDDALTLPEYAPDELFD-YVVGLGSEERFNRIWVSCQ-------------V 206
            :|.:.:.:|::...|.:     ...|:|:.| |..|        .|.::|:             .
 Worm   192 IISLNRLIGWRPTDYQE-----NSVPEEVKDRYKAG--------SIAINCRGATNVDQEHIGKVT 243

  Fly   207 IEPRVDIQFDYHPVRFFDAEELFTSGNVFLNESSDDDGPTYKEDPRLRRIISVRLSNIPINEDIQ 271
            ..|...|...|:|.       :||.|              |::.     |..|:...||.|:.:.
 Worm   244 YMPSNGIDGRYYPY-------VFTKG--------------YQQP-----IAMVKFDTIPRNKLVI 282

  Fly   272 IHCKAWAKNIP------LHMVTVKMLV 292
            :.|:|:|.||.      |.||..:::|
 Worm   283 VECRAYALNIEHDISSRLGMVYFEVMV 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5250NP_650793.1 Na_K-ATPase <143..281 CDD:298651 32/151 (21%)
nkb-1NP_492506.1 Na_K-ATPase 27..303 CDD:278704 69/325 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3927
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11523
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.