DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5250 and Atp4b

DIOPT Version :9

Sequence 1:NP_650793.1 Gene:CG5250 / 42308 FlyBaseID:FBgn0038691 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_033854.1 Gene:Atp4b / 11945 MGIID:88114 Length:294 Species:Mus musculus


Alignment Length:293 Identity:63/293 - (21%)
Similarity:103/293 - (35%) Gaps:107/293 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 TVCRFIKLLLYFIGFFFVL-GVFTTGLALVMIANHIY-PDRPGCKKFPGLATAP----------G 96
            |..|::.:.||:.||:.|: |:|...:.::|.....| ||.....|.||:...|          .
Mouse    33 TPARWVWISLYYAGFYVVMTGLFALCIYVLMQTIDPYTPDYQDQLKSPGVTLRPDVYGERGLKIS 97

  Fly    97 HHVGDQKQIMW--------------SPNNIKDVANIQRAIMRTVKRY----GLEGPKR------- 136
            ::|.:...  |              :|      |:.|.:|..|.::|    ....|..       
Mouse    98 YNVSENSS--WAGLTHTLHSFLAGYTP------ASQQDSINCTSEKYFFQESFAAPNHTKFSCKF 154

  Fly   137 ----LMGCN--IDDSWGYMSGTPCILIKITQALGFQAVTYDDALTLP--EYAPDELFDYVVGLGS 193
                |..|:  .|.|:|:..|.||.:||:.:.:.|          ||  ..||.           
Mouse   155 TADMLQNCSGLADPSFGFEEGKPCFIIKMNRIVKF----------LPSNNTAPR----------- 198

  Fly   194 EERFNRIWVSCQVIE----PRVD---IQFDYHPVRFFDAEELFTSGNVFLNESSDDDGPTY--KE 249
                    |.|...:    ||.|   :|.:|:|          .:|...|:..     |.|  |.
Mouse   199 --------VDCTFQDDPQKPRKDTEPLQVEYYP----------PNGTFSLHYF-----PYYGKKA 240

  Fly   250 DPRLRR-IISVRLSNIPINEDIQIHCKAWAKNI 281
            .|.... :::.:|.|:|.|..:.|.||..|.::
Mouse   241 QPHYSNPLVAAKLLNVPKNMQVSIVCKILADHV 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5250NP_650793.1 Na_K-ATPase <143..281 CDD:298651 35/149 (23%)
Atp4bNP_033854.1 Na_K_ATPase_bet 2..294 CDD:273446 63/293 (22%)
immunoglobulin-like. /evidence=ECO:0000250 194..294 24/114 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850790
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3927
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11523
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.