DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5250 and Atp1b2

DIOPT Version :9

Sequence 1:NP_650793.1 Gene:CG5250 / 42308 FlyBaseID:FBgn0038691 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_038201.1 Gene:Atp1b2 / 11932 MGIID:88109 Length:290 Species:Mus musculus


Alignment Length:279 Identity:61/279 - (21%)
Similarity:100/279 - (35%) Gaps:99/279 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 LLLYFIGFFFVLGVF--TTGLALVMIANHI--YPDRPGCKKFPGLATAP---------------- 95
            ||.|.:.:.|:..:|  |..:.|..:::|.  |.||...   |||...|                
Mouse    41 LLFYLVFYGFLTAMFSLTMWVMLQTVSDHTPKYQDRLAT---PGLMIRPKTENLDVIVNISDTES 102

  Fly    96 -GHHVGDQKQIMWSPNNIKDVANIQRAIMRTVKRY-------GLEGPKR--------LMGCN-ID 143
             |.||....:.: .|.|  |....|:..:....||       .|..|||        |..|: |.
Mouse   103 WGQHVQKLNKFL-EPYN--DSIQAQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGDCSGIG 164

  Fly   144 D--SWGYMSGTPCILIKITQALGFQAVTYDDALTLPEYAPDELFDYVVGLGSEERFNRIWVSCQV 206
            |  .:||.:|.||:.||:.:.:.|.|                        |:.:..|   |:|  
Mouse   165 DPTHYGYSTGQPCVFIKMNRVINFYA------------------------GANQSMN---VTC-- 200

  Fly   207 IEPRVDIQFDYHPVRFFDAEELF------TSGNVFLNESSDDDGPTYKEDPRL---RRIISVRLS 262
            :..|.:           |||.|.      .:|::.|...     |.|.:...:   :.:::|:..
Mouse   201 VGKRDE-----------DAENLGHFVMFPANGSIDLMYF-----PYYGKKFHVNYTQPLVAVKFL 249

  Fly   263 NIPINEDIQIHCKAWAKNI 281
            |:..|.::.:.|:..|.||
Mouse   250 NVTPNVEVNVECRINAANI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5250NP_650793.1 Na_K-ATPase <143..281 CDD:298651 28/148 (19%)
Atp1b2NP_038201.1 Na_K_ATPase_bet 2..289 CDD:273446 61/279 (22%)
immunoglobulin-like. /evidence=ECO:0000250 193..290 19/97 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850791
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3927
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11523
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.