DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5250 and Atp1b1

DIOPT Version :9

Sequence 1:NP_650793.1 Gene:CG5250 / 42308 FlyBaseID:FBgn0038691 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_033851.1 Gene:Atp1b1 / 11931 MGIID:88108 Length:304 Species:Mus musculus


Alignment Length:298 Identity:63/298 - (21%)
Similarity:119/298 - (39%) Gaps:109/298 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 FIKLLLYFIGFFFVL-GVFTTGLALVMIA----NHIYPDR---PGCKKFPGLATAPGHHVGDQKQ 104
            :.|:||:::.|:..| |:|...:.::::.    ...|.||   ||..:.|.:         .:.:
Mouse    32 WFKILLFYVIFYGCLAGIFIGTIQVMLLTISELKPTYQDRVAPPGLTQIPQI---------QKTE 87

  Fly   105 IMWSPNNIKD----VANIQRAI-----------------------------------MRTVKRYG 130
            |.:.||:.|.    |.||.|.:                                   .|.|.|:.
Mouse    88 ISFRPNDPKSYEAYVLNIIRFLEKYKDSAQKDDMIFEDCGNVPSEPKERGDINHERGERKVCRFK 152

  Fly   131 LEGPKRLMGCNIDDSWGYMSGTPCILIKITQALGFQ--------AVTYDDALTLPEYAPDELFDY 187
            |:......|.| |||:||..|.|||:||:.:.|||:        ..||.   .:.:|.|:.|...
Mouse   153 LDWLGNCSGLN-DDSYGYREGKPCIIIKLNRVLGFKPKPPKNESLETYP---LMMKYNPNVLPVQ 213

  Fly   188 VVGLGSEERFNRIWVSCQVIEPRVDIQF----DYH--PVRFFDAEELFTSGNVFLNESSDDDGPT 246
            ..|...|::           :...:|::    .|:  |::::                     |.
Mouse   214 CTGKRDEDK-----------DKVGNIEYFGMGGYYGFPLQYY---------------------PY 246

  Fly   247 YKE--DPR-LRRIISVRLSNIPINEDIQIHCKAWAKNI 281
            |.:  .|: |:.:::|:.:|:.::.:|::.|||:.:||
Mouse   247 YGKLLQPKYLQPLLAVQFTNLTVDTEIRVECKAYGENI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5250NP_650793.1 Na_K-ATPase <143..281 CDD:298651 34/154 (22%)
Atp1b1NP_033851.1 Na_K_ATPase_bet 1..304 CDD:273446 63/298 (21%)
immunoglobulin-like. /evidence=ECO:0000250 191..304 22/129 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850789
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3927
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11523
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.800

Return to query results.
Submit another query.