DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5250 and atp1b2b

DIOPT Version :9

Sequence 1:NP_650793.1 Gene:CG5250 / 42308 FlyBaseID:FBgn0038691 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_571913.1 Gene:atp1b2b / 114457 ZFINID:ZDB-GENE-010718-1 Length:292 Species:Danio rerio


Alignment Length:285 Identity:63/285 - (22%)
Similarity:106/285 - (37%) Gaps:99/285 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 LLLYFIGFF-FVLGVFTTGLALVM--IANH--IYPDRPGCKKFPGLATAPGHHVGDQKQIMWSPN 110
            :||:::.|: |:.|:||..:.:::  :.:|  .|.||   ...||:...|   .|:|.:|.::..
Zfish    32 ILLFYLAFYIFLAGLFTLTMYVMLQTLDDHRPTYQDR---LSTPGMMIRP---KGEQLEIAYTTE 90

  Fly   111 NIKDVANIQRAI----------MRTVKRY--------------GLEG-PKR--------LMGCN- 141
            ..:......:|:          ::|.|.|              ||:. |||        |..|: 
Zfish    91 YTETWERYVQALNNFLSPYNDTVQTQKNYECKPDQFFIQEDSGGLKNFPKRSCQFKRSILEKCSG 155

  Fly   142 -IDDSWGYMSGTPCILIKITQALGFQAVTYDDALTLPEYAPDELFDYVV------GLGSEERFNR 199
             .|..:||..|.|||:||:.:.:|.          ||  |.|....||.      .:|.:|    
Zfish   156 ITDRFYGYDEGKPCIIIKLNRVIGL----------LP--AKDGQPPYVTCGAKKYKVGKDE---- 204

  Fly   200 IWV-------SCQVIEPRVDIQFDYHPVRFFDAEELFTSGNVFLNESSDDDGPTYKEDPRLRRII 257
             |.       ......|.......|:|         :......:|.|              :.::
Zfish   205 -WTDDSDKLGELAYYPPNGTFNLMYYP---------YYGKKAQVNYS--------------QPLV 245

  Fly   258 SVRLSNIPINEDIQIHCKAWAKNIP 282
            :|:..||..|||:.:.||..:.|||
Zfish   246 AVKFLNITRNEDVNVECKINSNNIP 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5250NP_650793.1 Na_K-ATPase <143..281 CDD:298651 32/150 (21%)
atp1b2bNP_571913.1 Na_K-ATPase 7..283 CDD:278704 63/285 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596816
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3927
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11523
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.