DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5250 and atp1b4

DIOPT Version :9

Sequence 1:NP_650793.1 Gene:CG5250 / 42308 FlyBaseID:FBgn0038691 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_002664470.2 Gene:atp1b4 / 100037383 ZFINID:ZDB-GENE-070412-1 Length:347 Species:Danio rerio


Alignment Length:268 Identity:56/268 - (20%)
Similarity:97/268 - (36%) Gaps:78/268 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 LLLYFIGFFFVLGVFTTGLALVM--IANH--IYPDR---PGCKKFPGLATAPGH----------- 97
            ||.|...:.|:..:|...:..:|  |:.:  .|.||   ||...||.:.||.|.           
Zfish   100 LLFYAALYIFLAAMFAGCMCCLMWSISPYAPTYNDRVMPPGMTMFPHVDTAHGFDIAFNASDRSS 164

  Fly    98 ----------HVGDQKQIMWSPNNIKDVAN---IQRAIMRTVKRYGLEGPKRLMG-CN--IDDSW 146
                      |:......:.|..||....|   :|..:..:.:|...:..:..:| |:  .|..:
Zfish   165 WRRYAKTLEAHLKPYDDGLQSRRNIACKGNAYFMQEDLEESAERKACQFNRSSLGACSGLQDKDF 229

  Fly   147 GYMSGTPCILIKITQALGFQAVTYDDALTLPEYAPDELFDYVVGLGSEERFNRIWVSCQVIEPRV 211
            ||..|.||||:|:.:.||                      |:.|.|:.     :.|:|.:.:...
Zfish   230 GYSKGRPCILVKMNRILG----------------------YLPGQGTP-----VNVTCGLKKGST 267

  Fly   212 DI--QFDYHPVRFFDAEELFTSGNV-FLNESSDDDGPTYKEDPRLRRIISVRLSNIPINEDIQIH 273
            ::  :..:.|...||.......|.: .:|.||.              :::|:..|:..:..:.|.
Zfish   268 EVLGEVKFFPNPNFDLRYYPYYGKLRHVNYSSP--------------LVAVQFLNVQHDTPLHIQ 318

  Fly   274 CKAWAKNI 281
            ||...|.|
Zfish   319 CKLNGKGI 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5250NP_650793.1 Na_K-ATPase <143..281 CDD:298651 29/140 (21%)
atp1b4XP_002664470.2 Na_K-ATPase 71..340 CDD:278704 56/268 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596813
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3927
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11523
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.